Dating ja uk

DoULike is Online Dating Service where you can Meet Tucson Singles. Find your Match in Tucson Online Speed Dating in 10 Minutes! Jamaican dating has never been so easy and fun! Site features include Jamaican chat, photo profiles, and much more. In a few quick minutes you can start meeting single Jamaican women and men looking to meet their soulmate. Join JamaicanDating today for free and explore the profiles of beautiful Jamaican girls and men! Online Dating at Match.com. Every year, hundreds of thousands of people find love on Match.com. Match.com pioneered the Internet dating industry, launching in 1995 and today serves millions of singles in 24 countries.Match.com continues to redefine the way single men and single women meet, flirt, date and fall in love, proving time and again that you can make love happen through online dating ... With 43 billion matches to date, Tinder® is the world’s most popular dating app, making it the place to meet new people. Welcome to Attractive Partners, an exclusive and traditional dating agency, that has become one of the UK’s leading dating companies over many years, by offering outstanding personal service, privacy, confidentiality and caring for our clients to a standard that few others could achieve. 100% Free Online Japanese Dating, Personal Ads, and Matchmaking Service for Singles at japanesefriends.net. Visit us to find your love for free. Meet Jewish singles in your area for dating and romance @ Jdate.com - the most popular online Jewish dating community. An email with instructions on how to create a new password has been sent to Jehovah's Witnesses Dating. JWMatch is a safe and fun place for Jehovah's Witnesses and Friends to build loving and trusting friendships that can lead to lasting, offline relationships. The beauty of meeting and relating online is that you can gradually collect information from people before you make a choice about pursuing the relationship in the real world. When Plenty of Fish first hit the scene, online dating was a strange new world for those searching for that special someone. Since then, we've learned to 'like', 'follow', and slide our way into someone's DMs. Now that meeting on a dating app is the new normal, we're still finding ways for people to go on dates and make deeper connections.

List cheapest to get covid PCR tests

2020.09.18 04:03 orange_transparent List cheapest to get covid PCR tests

I was doing some research about where to get a PCR test and found this list on facebook, figured out it could be damn useful to anyone who wants to get tested.
Feel free to complete in the comments and I'll update the list.

TOKYO

Otemachi Sakura Clinic in Toyosu Fee:¥28,600(including tax, medical examination fee, PCR test fee and medical certificate issuance fee)
As for medical certificate, the clinic can give it in the evening of the next day after the test. The clinic can send it by e-mail as well.
URL: https://www.oscl.jp/
Koishikawa International Clinic Fee: ¥28,600 (including tax, medical examination fee, PCR test fee and medical certificate issuance fee)
As for medical certificate, the date of issue is undecided because it is outsourced.
URL: https://www.kic.clinic/
Travel Clinic located in Center Hospital of the National Center for Global Health and Medicine Fee:Around ¥28,500(tax included)+First consultation fee ¥2,820(tax excluded)
As for medical certificate, the clinic can give it from next day afternoon onward.
*Weekend closed.
URL: http://travelclinic.ncgm.go.jp/009/index.html
・Tokyo Medical University Hospital
Fee:¥30,620(tax excluded/consultation fee, PCR test fee, and medical certificate issuance fee included)
As a general rule, those who wish to undergo the test are supposed to visit the hospital twice. A medical certificate will be issued at the second visit. The medical certificate is issued at the earliest, two days after the test.
URL: https://hospinfo.tokyo-med.ac.jp/news/shinryo/20200616.html
KARADA Internal medicine clinic
Fee: ¥40,000 (including tax, medical examination fee, PCR test fee and medical certificate issuance fee). As for medical certificate issuance, it takes at least 2 days.
URL: https://karada-naika.com/
Hibiya Clinic
Fee:¥40,000(including tax, PCR test fee and medical certificate issuance fee)As for medical certificate, the clinic can give it 3 days after the test.
*Weekend closed.
URL: https://hibiya-clinic.com/covid_19_inspection_02/
Yamaoka Clinic Fee: ¥40,000 (tax excluded / medical examination fee, PCR test fee and medical certificate issuance fee included)
URL: https://www.yamaoka-clinic.com/
Shinagawa East Medical Clinic Fee: ¥45,000(including tax, PCR test fee and medical certificate issuance fee)
As for medical certificate, the clinic can give it from the next day (after 18:00) at the earliest.
*Weekend closed.
URL: https://izavel.com/

KANAGAWA

Travel Clinic Shin-Yokohama *French OK *Only business travelers accepted.
Fee: ¥35,000 (tax excluded / PCR test fee and medical certificate issuance fee included)Certificate is issued two days after the test.
TEL: 045-470-1011
URL: http://travelclinics.jp/
Fujisawa Honmachi Family Clinic Fee: ¥39,600 (including tax, PCR test fee and medical certificate issuance fee)
Certificate is issued two days after the test.
TEL: 0466-80-5815
URL: http://www.fhfc.jp/

OSAKA

Kansai Medical University Medical Center (Travel outpatient) Fee:¥36,000(including tax, health certificate issuance fee and medical certificate (translated in English) issuance fee)Date of issue: Monday, Wednesday and Friday
*Weekend closed
As a general rule, certificate is issued two days after the test. The certificate is issued the next day only if the test is conducted on Monday. The certificate is issued on the following Monday if the test is conducted on Friday.
TEL: 06-6992-1001
URL: http://www.kmu.ac.jp/takii/visit/treatment/suport_section/overseas_airlines.html
Uehonmachi Watanabe Clinic (Travel Clinic) Fee:¥30,000+tax / ¥55,000
If the test is conducted in the morning, medical certificate is issued on the day. /If the test is conducted in the afternoon, the certificate is issued the next day.If you undergo the test on Friday, the certificate is issued on the following Monday.
TEL: 06-6772-0075
URL: https://www.uehonmachi.jp/RT-PCR.html

FUKUOKA

Iizuka Hospital Fee:from ¥26,450(including medical certificate (translated in English) issuance fee)Certificate issued from the next day after the test.
*Weekend closed.
TEL: 0948-29-8916
URL: https://aih-net.com/depts/kansen/vaccines.php

Self test

Genesis-healthcare.jp (https://cp.genelife.jp/covid19pcr-en) provides a Kit for PCR test. Is based on saliva and it cost ¥13,000. Several clinics can to the test for you or preparing certification such as:

Tokyo

Medical Clinic Ebisu
https://mc-ebisu.com/
03-6450-2403
[[email protected]](mailto:[email protected])
Omorimachi Ekimae
https://omorimachi.com/pcoverseas/
03-6423-0428
Shirono Clinic Ebisu
https://www.shirono.net/about/clinic/ebisu.html
0120-11-4422
Shirono Clinic Ginza
https://www.shirono.net/about/clinic/ginza.html
0120-99-7474
Suganuma Mita Clinic
[[email protected]](mailto:[email protected])

Kanagawa

Shirono Clinic Yokohama
https://www.shirono.net/about/clinic/yokohama.html
0120-96-5454

Osaka

Shirono Clinic Osaka
https://www.shirono.net/about/clinic/osaka.html
0800-222-1112
Oue Clinic
https://ohue.jp/
072-445-2662
submitted by orange_transparent to japanlife [link] [comments]


2020.09.02 21:12 mr_tyler_durden Notes and Highlights of Kentucky Governor Andy Beshear’s Live Update September 2, 2020

Notes and Highlights of Kentucky Governor Andy Beshear’s Live Update September 2, 2020
Notes by mr_tyler_durden and Daily Update Team
Register for your Absentee Ballot here!
Watch here:
Headlines
Full Notes
(continued in stickied comment)
submitted by mr_tyler_durden to Coronavirus_KY [link] [comments]


2020.09.02 18:32 SuperHotUKDeals Xbox Deals with Gold - Region by region comparison per game [No VPN required] for Hungary, Norway and Czech Microsoft Stores

The description of this deal was not provided by this subreddit and it's contributors.
Xbox.com Store
Region by region comparison for purchasing games from the current Xbox Deals with Gold and Publisher sale at face value from non-UK stores using any credit or debit card (fee free cards e.g. Monzo, Starling, Revolut are obviously ideal) without the use of a VPN.
You are largely limited to the Hungary, Norway and Czech stores - the following list identifies which store is most cost effective per game and also notes where you are better off sticking with the UK store. Note - the following list may not be 100% up-to-date as the Xbox store and various comparison sites have been playing up all morning.
To get an idea of the savings to be made per game please refer to this week's UK Deals with Gold post:
[https://www.hotukdeals.com/deals/xbox-store-uk-deals-with-gold-spotlight-publisher-and-franchise-sales-01092020-includes-ubisoft-publisher-sale-3535186
](https://www.hotukdeals.com/deals/xbox-store-uk-deals-with-gold-spotlight-publisher-and-franchise-sales-01092020-includes-ubisoft-publisher-sale-3535186)
submitted by SuperHotUKDeals to HotUKGamingDeals [link] [comments]


2020.09.01 16:32 SuperHotUKDeals Xbox Deals with Gold - Region by region comparison per game [No VPN required] for Hungary, Norway and Czech Microsoft Stores

The description of this deal was not provided by this subreddit and it's contributors.
Xbox.com Store
Region by region comparison for purchasing games from the current Xbox Deals with Gold and Publisher sale at face value from non-UK stores using any credit or debit card (fee free cards e.g. Monzo, Starling, Revolut are obviously ideal) without the use of a VPN.
You are largely limited to the Hungary, Norway and Czech stores - the following list identifies which store is most cost effective per game and also notes where you are better off sticking with the UK store. Note - the following list may not be 100% up-to-date as the Xbox store and various comparison sites have been playing up all morning.
To get an idea of the savings to be made per game please refer to this week's UK Deals with Gold post:
https://www.hotukdeals.com/deals/xbox-store-uk-deals-with-gold-spotlight-publisher-and-franchise-sales-01092020-includes-ubisoft-publisher-sale-3535186
submitted by SuperHotUKDeals to HotUKGamingDeals [link] [comments]


2020.08.26 17:00 PelotonMod Pre-Race Thread – Le Tour de France 2020

The biggest race of the calendar is getting really close!
Le Tour de France starts Saturday, August 29th, and as we did in recent years, we open a Pre-Race Thread with links to previews, fantasy Leagues, interviews, news, our own /peloton threads and more.
Main Info
Official media channels
Previews
News
Fantasy Leagues
Interviews
Bookies favorites
  • Yellow: Roglic, Bernal, Dumoulin, Pinot, Pogačar, Carapaz, Alaphilippe, Buchmann, MA Lopez, Quintana;
  • Polka-Dots: Alaphilippe, Bardet, Roglic;
  • Green: Sagan, Sam Bennett, Van Aert;
  • Young Rider: Bernal, Pogačar, Sivakov;
  • (Data from Oddschecker, August 26th)
/peloton threads
Other
So please discuss everything related to Le Tour below! Any questions - please ask! Feel free to suggest more useful links, and check this thread later for more content
submitted by PelotonMod to peloton [link] [comments]


2020.08.25 03:08 Dezkin Daily COVID-19 Report for Clark County - Monday, Aug 24th

Clark County COVID-19 positives as of Monday, Aug 24th:
56786, ⬆️332 from 56464 (8/23)
-------
16-day tracking estimates:
-------
Current# COVID-19 in ICU:
# COVID-19 on HFNC Therapy:
# COVID-19 on ventilator:
# Remdesivir vials inventory:
# Staffed ICU beds inventory:
# Ventilators available: 434 (8/23)
# Ventilators in use: 319 (8/23)
# Ventilators inventory: 753 (8/23)
Source: https://nvha.net
-------
SNHD reports 87.4% (49621, ⬆️275 from 49346 (8/23)) of cases have recovered.
-------
Total Hospitalized: 3342*, ⬆️41 from 3301 (8/23)
*Hospitalized excludes deaths
-------
Total Deaths: 1028, ⬆️1 from 1027 (8/23) (656 with underlying medical conditions)
Not mutually exclusive conditions:
-------
Positive Results Age Range Breakdown:
-------
Hospitalized Age Range Breakdown:
-------
Deaths Age Range Breakdown:
-------
Note: Sunday's SNHD case report was not uploaded and the dashboard was down majority of the day (checked until 8pm). All case reports and dashboard is back up and running today.
Expect weekend report lag. "Daily case counts reflect newly reported cases and may represent cases that were tested in the preceding days, which could significantly impact the count on days when a relatively large number of laboratory reports arrive in one day." SNHD confirmed they are not counting COVID-19 antibody positives into their COVID-19 positive case counts.
Majority of information is pulled from Southern Nevada Health District's COVID-19 dashboard and historical reports.
Our positives have slowed down, our recovery rate continues to rise (85+% range), but our hospitalizations are increasing. Protect our vulnerable and continue to practice good hygiene habits, including wearing a mask to prevent asymptomatic spread as mandated by Governor Sisolak (onus is on businesses, which we want to keep open, but Metro will not enforce it; OSHA is responsible for mask enforcement by fining the business). To report a non-compliant business through the state, call (702) 486-9020 or (775) 688-3700.
Doctors are doing convalescent plasma therapy treatments and are seeking plasma donors to help those in need. One plasma donation can help five patients. Blood donors can get the antibodies testing done for free.
FDA states 144 trials of therapeutics are underway to treat COVID-19. 457 more are in planning stages. None have been approved. Remdesivir and Dexamethaaone are FDA approved for emergency base use.
Nevada was approved for the 24-hour test procedure. FDA has approved a 30-minute and a 5-minute testing procedures. UNLV provides the main COVID-19 testing services. The first at-home testing kit was FDA approved on 5/15.
Testing sites require an appointment; some may need to be scheduled by your primary care physician or another authorized provider.
City Serve coordinates testing sites throughout the valley. Testing is only on Saturdays. Schedule a no-cost test here: https://cityservelv.org/
The antibodies test was approved by the FDA a month ago. UMC, E7 Health and local laboratories are able to conduct antibodies testing. Cost is normally $149+, but your insurance may reimburse you for the test. Check your coverage first. Vitalant/Universal Blood Services will do a free antibody test for any eligible donors.
UMC is able to process 4,000 tests per day. It is encouraged for anyone to be tested. Symptoms are no longer required. Appointment is required.
UMC's testing sites are inside Thomas & Mack Center and Cashman Field Center. They can do 1,200 tests per day, Tues-Sat 8am to 4pm. No symptoms, insurance, or citizenship required for testing. Must schedule an appointment online through UMC's website (www.umcsn.com). A staff member will contact you back to schedule your appointment. According to their reps, there is no limit how often you can get tested. Sites are walk-in, appointment or walk-up. Both sites now use the self-nasal swab test kits.
UMC updates COVID-19 test guidelines:
New guidelines are to save test kits for those exhibiting symptoms.
See all testing locations on the SNHD website.
Three months ago, the first vaccine was tested. More than 160 vaccine prototypes are being tested. Clinical trials of the vaccine were administered two months ago. Phase 1 & 2 of trial vaccines have completed with positive antibody results. Phase 3 clinical trials started with 30k volunteers; large test size of 3k vaccine test trials in the UK. Africa started their vaccine trials last month. Multiple sources stating to expect an FDA approved vaccine by end of the year.
Of the 100+ vaccines submitted, 22 have made the cut to go through testing and final FDA approval phases (5/15 briefing). The front runner vaccine is conducting human trails (Phase 3 aka final stage), completion date in September. AstraZeneca is prepared to produce 2 billion doses once the vaccine is FDA approved.
Government is working with four vaccine manufacturers who are in the final phases of vaccine trials, all prepared for massive vaccine output once FDA approval is given (7/31). Two of the four have in the final review phases with FDA (8/14).
Phase 3 vaccine trials for Vegas has started. Volunteers can call 702-893-8968. Must be 18+. Administered by the Wake Clinical Research Center of Nevada. Source.
Remain mindful to give our medical community the ability to focus on those in need of their expertise to survive and combat the virus.
For Nevada COVID-19 metrics, with historical spreadsheet and graph data, visit: The Nevada Independent Coronavirus Tracking or check out the link in our side bar.
submitted by Dezkin to vegas [link] [comments]


2020.08.17 16:51 Danbla Where can I find crime statistics?

UNODC: International Statistics on Crime and Justice
The World Bank: Intentional homicides (per 100,000 people)

North America

  1. Canada: Statistics Canada
  2. United States: Uniform Crime Reporting and Bureau of Justice Statistics
  3. Mexico: Incidencia delictiva del Fuero Común

Europe

  1. Albania: Statistikat e Krimeve, T1 - 2018
  2. Andorra: Estadística de seguretat: Detencions
  3. Austria: Polizeiliche Kriminalstatistik (PKS)
  4. Belarus: Registered crimes and crime rate in the Republic of Belarus
  5. Belgium: Statistiques de criminalité
  6. Bosnia: Kriminalitet
  7. Bulgaria: Престъпления
  8. Croatia: STATISTIČKI PREGLED
  9. Cyprus: Ενημερωτικό / Διαφωτιστικό Υλικό
  10. Czechia: Statistiky kriminality and Statistické přehledy kriminality za rok 2019
  11. Denmark: Kriminalitet
  12. Estonia: Kuritegevus Eestis
  13. Finland: Taulukot
  14. France: Insécurité et délinquance en 2018 : premier bilan statistique
  15. Germany: Polizeiliche Kriminalstatistik
  16. Greece: Στατιστικά Στοιχεία
  17. Hungary: STATISZTIKAI ADATOK and BELÜGYMINISZTÉRIUM
  18. Iceland: Statistics Iceland Crime
  19. Ireland: Central Statistics Office Crime and Justice
  20. Italy: Delitti denunciati dalle forze di polizia all'autorità giudiziaria
  21. Kosovo
  22. Latvia: Reģistrēto noziedzīgo nodarījumu skaits
  23. Liechtenstein
  24. Lithuania: Nusikalstamumas ir baudžiamoji teisena
  25. Luxembourg
  26. North Macedonia
  27. Malta
  28. Moldova
  29. Monaco
  30. Montenegro
  31. Netherlands: Criminaliteit
  32. Norway: Sosiale forhold og kriminalitet: Kriminalitet og rettsvesen
  33. Poland: ROCZNE RAPORTY STATYSTYCZNE
  34. Portugal: Crimes registados pelas polícias: total e por algumas categorias de crime
  35. Romania: Baza de date TEMPO - serii de timp: selectati o matrice din domeniul JUSTITIE
  36. Russia: Статистика и аналитика
  37. San Marino
  38. Serbia
  39. Slovak Republic: Štatistika kriminality v Slovenskej republike
  40. Spain: Estadísticas de delincuencia en españa
  41. Sweden: Statistik utifrån brottstyper
  42. Switzerland: Polizeiliche Kriminalstatistik
  43. Turkey: Adalet İstatistikleri
  44. Ukraine: Статистична інформація з
  45. United Kingdom: Office for National Statistics Crime and justice
  46. Vatican City

South America

Asia

Africa

submitted by Danbla to crime [link] [comments]


2020.08.12 23:33 gumr89s0 Gramps v5.1.3 Released

Gramps v5.1.3 Releaseda new maintenance release, has been released on 2020-08-13.
Make sure to backup before you upgrade.
Downloads available:
If you have used Gramps and appreciate all the effort that has gone into making it what it is today, consider donating or even making a recurring monthly donation to the project to show your appreciation.
Another way of showing your support is to join Github and Star the Gramps projects source code so that other developers can see that people are actively using the program and would like it improved.
Changes since v5.1.2:
  • Update ca, de, fi, fr, ja, pl, ru, sl, sv, uk, zh_CN translation
  • Events View: "Main Participants" column does not show the full list of participants when expanded.
  • mac/gramps.modules: Use current Gtk release instead of Gtk-3.14.
  • mac/gramps.modules: Upgrade pymodules for Python 3.8 compatibility.
  • Fix XML export when 'Group-as" name contains XML invalid chars
  • Fix NarWeb: Province place-type is not displayed
  • Fix ManagedWindow so that new windows don't appear offscreen when system 'screen' sizes change in part time multi-monitor setups.
  • Fix menus when db fails to open due to upgrade/downgrade etc.
  • Fix issue with attach source tool, results panel
  • Fix GEDCOM export; don't include ADDR when address is missing
  • EditPlace: Allow Coordinates containing a comma instead of a period
  • NarrativeWeb: Should show patronymic in individuals. In the individuals and in surnames pages, we should show the complete name like defined in the display tab from the narrative web configuration.
  • NarrativeWeb: Fix Narrated Website Google Maps Output JS Warning SensorNotRequired
  • NarrativeWeb: Fix incorrect link type for osm css files
  • NarrativeWeb: Fix image size limit doesn't match tooltip
  • Update all translations for changes from 'Default' to 'Home' Person
  • Change GUI references to 'Home Person' instead of 'Default Person'
  • Use event attribute types in the event reference editor. In the event reference editor, custom event attribute types should be used rather than the default person attribute types.
  • Fix Verify tool bug caused by bad change in GObject introspection
  • Fix RemoveUnused tool for crash caused by Gtk introspection bug
  • Fix import test for change cause by previous change which was:
  • Fix GEDCOM import for bad source title when sources precede references.
  • Fix GEDCOM import for bad source title when sources precede references.
  • Fix some reports for CLI where warning message about Value not found
  • Fix Genealogy Tree reports for crash in CLI
  • Add uistate to tree views filter initialization
  • Fix some Python syntax errors that appear in v3.8.x
  • Suppress age = 0 days in events list. If the reference event date is equal to the event date, don't show the age except if the date is estimated, calculated, etc.
  • Fix Dashboard Gramplets to update during db close when not shown
  • Fix Windows GUI mode startup for crash with some languages
  • Fix dbapi to support "Abandon Changes & Quit" feature
  • Fix GrampsType for comparison bug with empty string as one value
  • Fix Date Display so that it uses LC_TIME if defined
  • Fix StyledText so serialize will match for style list order changes
  • Try to fix exceptions on ManagedWindow close
  • Fix Mac SQLite3 locale bug when locale contains non-ascii characters
  • Fix issue when Person has Same date of birth and death; gives an error.
  • Geography: add a popup for a bad tiles path
  • Fix GEDCOM export of estimated/calculated dates with modifers
See the changelog for more details.
You can obtain Gramps 5.1.3 from the GitHub release page.
submitted by gumr89s0 to gramps [link] [comments]


2020.08.08 22:03 ReconEG [AMA ANNOUNCEMENT] Glass Animals on Wednesday, August 12th @ 11 AM PT / 2 PM ET / 7 PM BST! (UPDATED)

[AMA ANNOUNCEMENT] Glass Animals on Wednesday, August 12th @ 11 AM PT / 2 PM ET / 7 PM BST! (UPDATED)
This is an updated version of an AMA announcement we made earlier today, as the band will now be joining us this Wednesday, August 12th at 11 AM PT / 2 PM ET / 7 PM BST. Apologies for the confusion.
Glass Animals joins us for an AMA this Wednesday (Photo: Pooneh Ghana, Graphic: u/sara520)
Well folks, after almost three years, we have finally rescheduled the Glass Animals AMA as the band will now be joining us this Wednesday at 11 AM PT / 2 PM ET / 7 PM BST!
Their new album, Dreamland, is out now via Wolf Tone and features the singles "Tokyo Drifting" ft. Denzel Curry, "Your Love (Déjà Vu)", "Dreamland", "Heat Waves" and "It's All So Incredibly Loud." Additionally, they released the Quarantine Covers EP featuring covers of Lana Del Rey & Nirvana, with more covers on their YouTube along with a number of live videos including a Dave solo version of "Heat Waves" in an empty concert hall and "Heat Waves" again in the streets of London busking, but with Drew on guitar! They also announced a European/UK tour for 2021 (dates posted below), so if they're playing near you, pick up some tickets on their website along with some other goodies!
Welcome to Dreamland Tour 2021
With that said, swing back this Wednesday as Glass Animals finally join us for an AMA, and make sure to follow us on Twitter or Instagram to hear about AMAs as they get announced!
submitted by ReconEG to indieheads [link] [comments]


2020.07.13 20:21 LearningIsListening A not-so-brief rundown of letters G-I in Jeffrey Epstein's 'Black Book'

Below is a rundown of letters G-I of Epstein's contacts. Last year, I wrote about letters A-C. You can check that out here (https://www.reddit.com/conspiracy/comments/cpis3n/a_brief_rundown_of_the_first_ten_pages_of_jeffrey/).
I also wrote about letters D-F on July 5, 2020. You can check that out here (https://www.reddit.com/conspiracy/comments/hlrba8/a_notsobrief_rundown_of_letters_df_in_jeffrey/). There are some misspelled names. Epstein entered their names like this.
I have bolded some of the more interesting connections and information, but there could be much more that I overlooked. I hope something here strikes an interest in someone and maybe we can get more investigations out of this. Please, if you know anything more about any of these people than what is presented here, post below. I am working off of the unredacted black book found here: https://www.coreysdigs.com/wp-content/uploads/2019/07/Jeffrey-Epsteins-Little-Black-Book-unredacted.pdf
G-I
Gaetani, Gelasio: Count Gelasio Gaetani comes from one of the oldest families in Rome. The Gaetani (also known as Caetani) family has produced 3 popes, including Pope Boniface VIII. Gelasio is a wine specialist and vineyard owner who helps celebrities buy the most unique bottles of wine throughout the world.
Gaetani, Rufreido: Roffredo Gaetani was an Italian count, prince, and duke who died in a car crash in 2005. Roffredo came to the public’s attention when he dated Ivana Trump in the 1990s. Brother of Gelasio.
Gallman, Kuki: Kuki Gallmann is a best-selling author (5 of her books were global best sellers), poet, environmental activist, and conservationist. Owns a 98,000 acre cattle ranch in Kenya with her husband, which she turned into a conservation park.
Ganero, Mario Jr.: Where do we even begin? Mario Garnero is a Brazilian banker and entrepreneur who has been deemed the “father of the ethanol car” and is the chairman of the board and primary shareholder of Brasilinvest Group, a banking firm worth $700 million. Garnero’s connections run extremely deep. He is/has been personal friends with Jacob Rothschild, David Rockefeller, Bill Clinton, George H. W. Bush, Gerald Ford, Ronald Reagan, Henry Kissinger, Helmut Schmidt, and many others. The following website makes some startling connections between Garnero, Epstein, and others (source: https://aeltri.com/2019/02/12/john-of-god-mario-garnero-and-epstein/). Quick summary: Record producer Damon Dash (former co-founder of Roc-A-Fella Records with Jay-Z) allegedly raped a supermodel who worked for Naomi Campbell at a party thrown by Garnero (source: https://www.standard.co.uk/news/poshs-friend-sued-for-rape-6939248.html).
Garnero has been referred to as a “Rothschild pawn” who tried to help Aecio Neves rise to power. Garnero also appointed “George Soros frontman, Arminio Fraga, who worked in Soros’ Quantum Fund, as Minister of the Economy.”
Ganoza, Esteban Juan: A Peruvian businessman who said he met Maxwell in the 1980s when he lived in New York, but denied any ties to pedophilia when his contact information was revealed to be in Epstein’s ‘Black Book.’
Garcia, Ludmila: No info found.
Gardner. Adam: No info found.
Garland, Michael: Likely the Chairman of investment firm C5 Capital, located in London.
Garson, Jeremy: Likely refers to the lawyer who is a partner at Herbert Smith Freehills who specializes in large-scale international commercial disputes. Not completely positive, though.
Gaspar, Nacho: Not sure. Could be a number of Ignazio Gaspars, all of whom are businessmen.
Gaul, Harriett: Harriett Jagger is a fashion stylist and former fashion director of Tatler, a fashion magazine owned by Conde Nast (parent company of Vogue, GQ, etc.), which has come up several times during my investigations, and Harpers. She had a daughter with property dealer Simon Gaul, the Godson of Prince Rainier of Monaco.
Geary, Tim: Served in public relations and was Director of Membership at Soho House, a restaurant and private members club. Billionaire Ron Burkle owns 60% of Soho House. Burkle, along with Bill Clinton, Chris Tucker, Kevin Spacey, travelled to Africa for an anti-poverty, anti-AIDs tour on Epstein’s Lolita Express. Nothing fishy there.
Gelardin, Jack: No info found. The address listed is located in Chelsea, London, and sold for over 5 million pounds in 2013.
German-Ribon, Catriona: Catriona Blampied (nee German-Ribon) is the Managing Partner, Founder, and Owner of talent agency Procure Worldwide & Procure Digital since 2016. Worked as Managing Director at Platinum Rye Entertainment, another talent agency, before that.
Gertler, Eric: A venture capitalist who served as Chairman of U.S. News & World Report, a media company most known for publishing news, consumer advice, and rankings ranging from education (top universities, high schools, etc.) to job professions, healthcare, and too many others to mention. In 2019, Governor Andrew Cuomo nominated Gertler to serve as President and CEO of Empire State Development, New York’s chief economic agency. In Epstein’s ‘Black Book,’ Privista is listed under Gertler’s name. Privista is a company that protects against identity theft. Gertler was President and CEO.
Getty, Mark: Co-founder and Chairman of Getty Images, a photographic conglomerate. If you have ever surfed the Internet, you have seen several pictures/images belonging to Getty Images. From 2008-2016, Getty was the Chairman of the Trustees of the National Gallery in London. Grandson of Jean Paul Getty Sr., founder of Getty Oil Company, and one of the richest men in the world during his time. The Getty Family has a net worth north of $5 billion as of 2015.
Getty, Pia and Chris: Pia Getty is the daughter of billionaire Robert Warren Miller, an American-born British businessman and founder of Duty Free Shops. Pia’s sisters are Princess Alexandra von Furstenberg of designer fame and Maria-Chantal, Crown Princess of Greece, Princess of Denmark. Her ex-husband (1992-2005), Christopher, is Mark Getty’s first cousin. Christopher is also the grandson of Jean Paul Getty Sr. When they were married, Pia and Mark would hold A-list parties on the rooftop of their Manhattan townhouse. Their townhouse was located half a mile from Jeffrey Epstein’s mansion. Many people think that the Getty Museum in Los Angeles houses an underground base and city for the elites.
Gibbs, Emma: Former girlfriend of Prince Andrew. Gibbs was introduced to Prince Andrew by her good friend, Ghislaine Maxwell. Gibbs worked as a PR consultant.
Gibson, Caroline: Likely to be the award-winning freelance copywriter and content writer who has worked on a number of high-profile advertisements.
Gilifilan, Andrew: Managing Director of Europe, the Middle East, and Africa for Cambridge University Press. Retired in 2012.
Gillford, Lord & Lady: Lord Gillford is Patrick Meade, the 8th Earl of Clanwilliam. He is a businessman who is on the board of Soma Oil & Gas Holdings and Eurasia Drilling Company, where he served as Chairman. Eurasia Drilling Company is owned by Russian billionaire oligarch, Alexander Dzhaparidze and billionaire Alexander Putilov.
Gilmour, Andrew & Emma: Gilmour is a diplomat for the UN who has spoken out strongly against Israel’s treatment of Palestinians. Gilmour’s father, Sir Ian Gilmour, served as a minister in Margaret Thatcher’s first cabinet. Emma Gilmour (nee Williams) is a physician and author.
Ginsberg, Gary: Former Executive VP of Global Marketing and Corporate Affairs at Rupert Murdoch’s News Corp, the fourth-largest media group in the world prior to splitting in 2013. Ginsberg was a close confidant of Rupert Murdoch and Peter Chernin while at News Corp. Ginsberg also served in the Clinton Administration at the White House Counsel’s Office and Department of Justice. Ginsberg has brokered meetings between Rupert Murdoch and the Clintons, as well as Obama. Ginsberg is currently on the Board of Directors of New Visions for Public Schools, which designs course curricula for students in NYC. New Visions supports many schools, impacting 230,000 students (source: https://newyorkschooltalk.org/2019/07/at-new-visions-for-public-schools-its-all-about-continuous-school-improvement-hows-that-going/). Their Networks for School Improvement Initiative is funded by the Bill and Melinda Gates Foundation. New Visions also has ties to the Carnegie Foundation, which donates millions of dollars in grants (source: https://www.carnegie.org/grants/grants-database/grantee/new-visions-for-public-schools-inc/#!/grants/grants-database/grant/312395808.0/). Ginsberg is also a friend of and speechwriter for Israeli Prime Minister Netanyahu.
Gittis, Howard: Gittis (1934-2007) was an attorney and adviser to billionaire businessman Ron Perelman. He worked at MacAndrews & Forbes, an investment firm owned by Perelman. In 1995, Perelman hosted a dinner with Bill Clinton, Jeffrey Epstein, Clinton college friend Arnold Paul Prosperi, Don Johnson, Jimmy Buffett, and Don Fowler, who was the co-chairman of the DNC. More on Perelman later.
Giussani, Luca: President, CEO of Dorial Telecom, Inc., a telecommunications company.
Glanville, Mary: A philanthropy consultant who spent years in TV, Glanville also worked as a PR contact for the Bonita Trust which donated £100,000 to the National Society for the Prevention of Cruelty to Children (NSPCC) back in 2009 to “update its ChildLine technical infrastructure and purchase essential equipment so that more children can get help from its ChildLine service” (source: https://www.prweb.com/releases/2009/07/prweb2625274.htm). Glanville was the author of that PR statement.
Glass, Charlie: Could possibly be Charles Glass, author, publisher, and journalist that specializes in the Middle East, but I cannot confirm.
Glentworth, Edmund & Emily: Edmund Pery is the 7th Earl of Limerick and was formerly known as Viscount Glentworth. He worked in British government until becoming director of Deutsche Bank. Emily is Edmund’s wife.
Goess, Pilar: A countess and Austrian-American model who posed for Playboy. Goess died in 1999 from a brain tumor.
Goldberg, Ellen: President of Santa Fe Institute, an organization in New Mexico that hosts faculty consisting of Nobel Laureates, members of the National Academy of Sciences, and MacArthur fellows. Goldberg is also a research professor in the Department of Biology at the University of New Mexico. Dr. Goldberg is a member of the Biology Advisory Committee of the National Science Foundation, and of the National Advisory Allergy and Infectious Diseases Council at the National Institutes of Health. Goldberg has a Ph.D. in genetics from Cornell University Medical College.
Goldsmith, Isabel: An art collector and owner of Hotel Las Alamandas in Mexico. Goldsmith is the daughter of Sir James Goldsmith, a French-British financier, tycoon, and member of the European Parliament.
Golinkin, Sandy: Former Vice President and Publisher of Lucky, a fashion and lifestyle magazine owned by Conde Nast. Has frequently been photographed with celebrities and elite at various parties.
Gomez, Thomas: Thomas Gommes is a former international corporate lawyer.
Gomme, William & Emma: William Gomme is a former director of several furniture manufacturing companies in London. Emma is his wife.
Gordon, Jacobo: Spanish businessman who co-founded several real estate and gaming companies with Alejandro Agag. Agag is a former politician in Spain. He became Secretary General of the European People’s Party (EPP), a tremendous political faction in Europe. Agag played a huge role in getting former Italy PM Silvio Berlusconi’s party into the EPP. Berlusconi has been charged for underage prostitution in the past. Agag quit politics to pursue financial and sporting interests. He is married to the daughter of Jose Maria Aznar, the former PM of Spain and Ana Botella Serrano, the first female mayor of Madrid. Guests at Agag’s wedding included kings and queens. Berlusconi and Tony Blair served as witnesses.
Gore, Juliet: The only Juliet Gore I found is the co-director of Neuro Orthopaedic Institute out of Australia. Doesn’t feel right.
Gottlieb, Steve: A music executive who discovered Nine Inch Nails, Pitbull, Sevendust, and Ja Rule. He has served on the boards of Napster and Musicmatch. He is currently CEO of Shindig, a Zoom-like platform for people to meet each other online.
Goulandris, Dimitri: Founder of The Cycladic Group, which invests and creates businesses. Spent 8 years at Morgan Stanley in its private equity group. Goulandris is the Executive Director and a Board Member for Knightsbridge Schools, which has 3 schools (KSI Montenegro [a boarding school], KSI Bogota, and KSI Panama), all of which are primary/secondary schools for students aged 2-18.
Grabau, Lorenzo: Spent seventeen years at Goldman Sachs before becoming CEO of Investment AB Kinnevik, a Swedish investment firm. He was fired less than 3 years after taking the position.
Graff, Francois: CEO of family-owned Graff, one of the world’s most notable jewellery houses. The company is worth several billion dollars. Graff has been photographed with the likes of Wilbur Ross. In 2001, there was a party celebrating the opening of a new Graff’s store. Attendees included Ghislaine Maxwell, Ivana Trump, Joan Collins, and Denise Rich (source: https://www.nytimes.com/2001/06/05/style/IHT-laurence-graff-and-his-pockets-full-of-diamonds-the-buccaneer-of.html)
Granby, David: David Charles Robert Manners is the 11th Duke of Rutland. He also goes by the Marquess of Granby. Granby is a high-profile supporter of the UK Independence Party and has hosted fundraising events at his ancestral home, Belvoir Castle. Employed Harvey Proctor, the former Conservative Parliament member who had to resign because he had sexual relations with underage male prostitutes, as his personal secretary.
Grange, Jacques: A French interior designer for the rich. Clients include Princess Caroline of Monaco, Francis Ford Coppola, Alain Ducasse, and several billionaires, to name a few.
Grant Jamie: Likely James Grant, owner of No2 Pound Street, an award-winning wine shop that specializes in British Cheese and cured meats. He and his wife previously worked at some leading hotels and restaurants.
Greece Princess Olga: Princess Olga, Duchess of Apulia (nee Princess Olga Isabelle of Greece) married her second cousin, Prince Aimone of Savoy, Duke of Apulia, in 2008. Olga’s father is first cousins with Prince Phillip (Queen Elizabeth’s wife).
Greece, MC & Pavlos: Pavlos is the eldest son of Constantine II, the last King of Greece, before the monarchy was abolished in 1973. Worked in New York as an investment portfolio manager. MC is his wife, Marie-Chantal, Crown Princess of Greece. Her father is the billionaire founder of Duty Free Shops. Her sisters, Alexandra and Pia, married into the von Furstenberg and Getty families, respectively. A dinner party was thrown for them at the Standard Hotel in 2009. There were about 12 guests there. One of those exclusive guests was Ghislaine Maxwell (source: https://wwd.com/eye/people/royal-standard-a-fete-for-princess-marie-chantal-and-prince-pavlos-2399957/)
Green, Deborah: No info found.
Green, Jeremy: Likely the former Chief Executive of Quba Property Holdings in South Africa.
Green, Judy: A New York socialite who hobnobbed with an elite crowd. She was considered Andy Warhol’s first muse. He did her photo portrait and she starred in his first movie, The Kiss. She was reportedly close with Frank Sinatra. Edgar M. Bromfman served as Best Man at her wedding to William John Green in 1964. Bromfman is the owner of Seagram, the beverage company. His daughters, Clare and Sara, were members of NXIVM, a cult that recruited women and forced them into sexual slavery.
Gregg Geordie & Katherine: Geordie Grieg is an English journalist and editor of The Daily Mail. Grieg is good friends and has been photographed partying with Ghislaine Maxwell. He is the former editor of Tatler, a Conde Nast-owned British magazine that is targeted towards the upper class and those interested in high society events. Tatler connections come up constantly in the ‘Black Book.’
Grenfell, Natasha: Daughter of Lord St Just, heir to a banking fortune and Wilbury Park mansion. Her mother was actress and one-time Tennessee Williams love interest, Maria Britneva. Natasha is a socialite who has is friends with royalty, actors, and musicians
Griffen, Ted: This is most likely screenwriter, producer, and director Ted Griffin. He has worked on The Wolf of Wall Street, Ocean’s Eleven, and Tower Heist.
Griscom, Nina: A model, socialite, TV personality, and entrepreneur who died earlier this year. Her first husband was a modeling booker for Ford Models, which I wrote about in the D-F section of Epstein’s ‘Black Book’ (link: https://www.reddit.com/conspiracy/comments/hlrba8/a_notsobrief_rundown_of_letters_df_in_jeffrey/). She went on to cheat on her next husband with sugar billionaire Pepe Fanjul, who is also mentioned in the D-F link above. Was a close friend of Blaine Trump, ex-wife of Robert Trump, Donald’s younger brother.
Gross, Pamela & Jimmy Finkelstein: James Finkelstein is the owner of The Hill, an American news website often cited here in /conspiracy. He is close with Donald Trump and Rudy Giuliani. Pamela Gross is his wife. She worked at CNN until 2017 and is close friends with Melania Trump.
Grossman Lloyd: Loyd Grossman is an British author and broadcaster best known for hosting Masterchef from 1990-2000, before it was reformatted. Also co-created Through the Keyhole, a British game show, with David Frost, who is also in Epstein’s ‘Black Book.’
Gubelmann, Marjorie: A socialite who is best known for hosting and performing as a DJ at high society parties. She has deejayed events for Bulgari, Versace, and others. She is currently the in-studio DJ for the Today with Hoda & Jenny show on NBC. Her ex-husband, Reza Raein works in oil. Guests at their wedding included Ivanka Trump, Tamara Mellon, Michael Kors, and Tory Burch.
Guccioni, Tony: Son of Penthouse creator Bob Guccione.
Gudefin, Christian: A financial advisor at Deutsche Bank, which as of Tuesday, July 7th, 2020, agreed to pay $150 million in fines because they ignored suspicious transactions made by Jeffrey Epstein (source: https://www.nytimes.com/2020/07/07/business/jeffrey-epstein-deutsche-bank-settlement.html?referringSource=articleShare). Gudefin is also a financial advisor at Fdx Capital LLC and Managing Partner at Confidas Capital.
Guedroltz, Solina & Nicolas: Solina is a photographer. Her father is a viscount. Nicolas is an antique Russian furniture dealer. He is a Russian prince and is of Belgian nobility through his mother’s side.
Guerini Maraldi, Alessandro: Chairman of Willis Towers Watson, a British insurance company. Guerrini-Maraldi’s name appears in the Panama Papers, which revealed the identities of many rich and powerful people who have avoided paying taxes through offshore accounts.
Guerrand-Hermes, Valesca: Socialite and ex-wife of French fashion house heir, Mathias Guerrand. Guerrand-Hermes is on the Board of Directors of the New York Society for the Prevention of Cruelty to Children (NYSPCC) (source: https://nyspcc.org/about-the-new-york-society-for-the-prevention-of-cruelty-to-children/people/). NYSPCC is a child protection agency. Photographed with Ghislaine Maxwell at the 2005 Wall Street Concert Series Benefitting Wall Street Rising at Cipriani Wall Street in New York City. You can’t make this stuff up.
Guest, Cornelia: Named Debutante of the Decade of the 1980s, Cornelia is a well-known New York socialite who comes from money. Her family made money in iron and steel and have served in British politics. In December 2015, Ghislaine Maxwell attended Cornelia’s holiday party.
Guggenheim, Barbara & Bert Flelds: Guggenheim (not part of the Guggenheim museum family) is a partner at the well-known art advisory firm, Guggenheim, Asher Associates, Inc. They have built collections for Coca Cola and Sony, as well as Tom Cruise and alleged pedophile Steven Spielberg. Epstein victim Maria Farmer once worked for Barbara at her home before meeting Epstein. Farmer got the job through Barbara’s sister, Eileen, who has been accused of being an Epstein enabler. A petition (https://www.change.org/p/david-kratz-eileen-guggenheim-must-be-removed-for-harm-she-caused-to-maria-farmer-by-jeffrey-epstein?recruiter=30424804) to have her removed as Chair of the Board of Trustees of the New York Academy of Art as a result of Maria Farmer’s allegations has over 10,000 signatures. Farmer says that Eileen Guggenheim forced her to sell a painting replicating Degas’s “The Rape” to Epstein. Two weeks after meeting Epstein and Maxwell, Guggenheim took Farmer and other art students to Epstein’s Zorro Ranch in New Mexico (source: https://news.artnet.com/art-world/epstein-ranch-art-students-1760265). Barbara’s husband, Bert Fields, is an entertainment lawyer who has represented the likes of Steven Spielberg, Bob and Harvey Weinstein, George Lucas, Michael Jackson, The Beatles, etc.
Guiness, Sabrina: Guinness comes from a long line of wealthy bankers. She had a relationship with Prince Charles in 1979. Cousin of Edward Guinness, 4th Earl of Iveagh, heir to the Guinness fortune. Edward Guinness’s wife, Lady Clare Iveagh (nee Hazell) plays a HUGE role in Epstein’s pedophilia ring. More on her later (she is listed under I for Iveagh). Her sister, Anita Guinness, was married to Amschel Rothschild until his suicide in 1996.
Guinness, Mr Hugo: An artist from the same banking family as sister Sabrina (above). Guinness has collaborated with director Wes Anderson on a number of films. Cousin of Edward Guinness, 4th Earl of Iveagh, heir to the Guinness fortune. Edward Guinness’s wife, Lady Clare Iveagh (nee Hazell) plays a HUGE role in Epstein’s pedophilia ring. More on her later (she is listed under I for Iveagh).
Guissaini, Luca: Listed above under Giussani, Luca. CEO of Dorial Telecom.
Gumberg, Ira: Chairman and CEO of JJ Gumberg Co., a high-end real estate development firm based out of Pittsburgh. Gumberg served on the Board of Mellon Financial Corporation from 1989-2007.
Guttfreund, Susan & John: Susan is a former beauty queen and notorious party thrower. Her husband, John, was CEO of Salomon Brothers, the large investment bank. He was dubbed the “King of Wall Street” by Business Week in 1985. He died in 2016.
Hahn, Dr & Mrs: Likely Carl Hahn, former head of Volkswagen.
Hall, Pippa: There are two Pippa Halls that this could possibly be. One is a movie casting director who was in charge of casting children for movies (source: https://www.imdb.com/name/nm0356002/). The other Pippa Hall is Director of Innovation and Chief Economist at the UK Intellectual Property Office (IPO). There is not enough info to determine which one is in the ‘Black Book.’
Halpern Jen: A British philanthropist, PR guru, and businesswoman. Her father was knighted by Margaret Thatcher.
Hambro, Clementine: Great-granddaughter of Winston Churchill who also served as a bridesmaid at the wedding of Prince Charles and Princess Diana when she was just five-years-old. Her father, Richard, was a British heir and investment banker. K
Hamilton, George: Famous actor who took Ghislaine Maxwell to the Epsom Derby (horse race) in 1991. Epstein has a significant amount of phone numbers listed for Hamilton.
Hammond, Dana: Socialite and heiress to the Annenberg Publishing fortune. Hammond is friends with Ghislaine Maxwell. They have been photographed together at various parties.
Handler, Sharon: International attorney who is friends with Camilla Parker-Bowles and Prince Charles. Married to John Langeloth Loeb Jr., former United States Ambassador to Denmark under Reagan.
Hanover, Ernst & chantal: Prince Ernst Hanover is the head of the royal House of Hanover. The House of Hanover has produced six British monarchs, including King George III and Queen Victoria. The current British monarchy, the Windsors, are actually of German and British descent, which is why these family trees intersect. Most notably, the House of Hanover is perhaps the most important of the Black Nobility families. There have been some fantastic threads on Reddit about the Black Nobility.
Hanson, Brook: Adopted son of British industrialist, Lord Hanson, Brook died in 2014 at the age of 50.
Hanson, Lord & Lady: British industrialist who made a fortune in the ‘80s as a Trade and Industry Secretary in close friend Margaret Thatcher’s administration. His wife, Geraldine, was a former model. They are both dead.
Hanson, The Hon Robert: British financier and eldest son of Lord Hanson. Chairman of Hanson Family Holdings, a private investment firm. In the 1980s, Robert worked as a banker at NM Rothschild & Sons before returning to his father’s company. Before getting married, Hanson dated socialite Anouska de Georgiou, who became the first British woman to accuse Jeffrey Epstein of raping her as a teenager (source: https://www.nbcnews.com/news/us-news/how-british-teen-model-was-lured-jeffrey-epstein-s-web-n1056901). Odd that Robert Hanson, his brother Brook, and his parents would have wanted anything to do with Epstein.
Hapsburg, Marie: Royalty. Her father was Archduke Joseph Arpad of Austria and her mother, Archduchess Maria of Austria, was a Princess of Löwenstein-Wertheim-Rosenberg and a member of the House of Löwenstein-Wertheim-Rosenberg by birth. The Hapsburg (also called Habsburg) family is one of the most powerful and wealthiest families in Europe. The Hapsburgs are another Black Nobility family of very high prestige. I couldn’t find anything out about her husband, Raymond van der Meide. They have 7 children together.
Harvey Victoria: Ex-girlfriend of Prince Andrew, Hervey is an English model and socialite. Although her relationship with Andrew didn’t work out, she remained in his inner circle. In 2000, she attended a dinner with Prince Andrew, Bill Clinton, Donald Trump, and Jeffrey Epstein (source: https://www.thesun.co.uk/news/9844083/lady-victoria-hervey-jeffrey-epstein-too-old/). Hervey is also a friend of Ghislaine Maxwell, who introduced her to Epstein and “set her up in one of Epstein’s apartments in New York.” Hervey is the daughter of Victor Hervey, 6th Marquess of Bristol, businessman and member of the House of Lords.
Harvey-Watt, Isabelle: Director of PR for Giorgio Armani before moving on to Versace and other well-known fashion corporations.
Haslam, Nick: English interior designer and socialite. His mother was the Goddaughter of Queen Victoria. Haslam claims to have had an affair with Lord Snowdon one year before he married Princess Margaret (Queen Elizabeth’s sister), further fueling rumors of Lord Snowdon’s alleged bisexuality.
Hatkoff, Craig & Jane: Hatkoff is a real estate investor, who, along with his ex-wife, Jane Rosenthal, and Robert De Niro, founded the Tribeca Film Festival and the Tribeca Film Institute. Hatkoff has donated hundreds of thousands of dollars to the Clinton Foundation.
Hauteville, Marc de: Manages Soc Civile du Frayssinet, a real estate company based out of France. There is very little information other than this. Both of his parents appear to be members of noble families - the Hautevilles and the Cazenoves - who have historical ties to the Du Ponts.
Hay, Henry & Patricia: Henry Hay is CEO and co-founder of Centaur Properties, a large real estate firm based out of New York. Centaur’s holdings are concentrated in the most expensive neighborhoods in Manhattan.
Hayworth Reggie: Heyworth runs the 160 acre Cotswold Wildlife Park, which attracts more than 400,000 people a year. He lives in the middle of the park at the Bradwell Grove estate. .
Hazell-Iveagh, Clare: This amazing thread made by clemanueverers contains all the info you need: https://www.reddit.com/conspiracy/comments/hkk5g0/one_of_epstein_madam_ghislaine_maxwells/. Quick summary: Hazell-Iveagh helped Maxwell and Epstein procure children using her position as President of West Suffolk National Society for the Prevention of Cruelty to Children (NSPCC). Click on the link. Clemanueverers did a wonderful job.
Hearn, Barry & Susan: Barry is a hugely popular English sports promoter, as is his son, Eddie, who represents some of the biggest boxers in the world. Former boxer and popular Youtuber Tyan Booth was supposedly banned immediately after posting a video connecting Epstein to Hearn. I have tried to find the video or at least a summary of what he said, but have been unsuccessful. If anyone has any info on this, please post below.
Hefner III, Bob: Founder and CEO of GHK Companies, which specializes in oil and natural gas. Founded the Robert and MeiLi Hefner Foundation which sponsors educational trips to China for outstanding high school students. His grandfather, Robert Hefner Sr., served as Mayor of Oklahoma City, was a Supreme Court Justice of Oklahoma, was a member of the executive council of the Boy Scouts of America, and was a thirty-second degree Freemason. Although I try not to engage in speculation, this article makes a connection between Jeffrey Epstein, Bob Hefner III, and a winning Powerball lottery ticket that was purchased in Oklahoma in 2008 (source: https://www.thelostogle.com/2019/08/14/no-jeffrey-epstein-did-not-win-25-million-from-an-oklahoma-lottery-ticket-or-did-he/#comments). It’s too long to summarize. Read it and check it out.
Heiden, Lisa: Worked in Manhattan and London as an executive for ABC. Close friend of Ghislaine Maxwell. According to the fantastic research done by this person (https://twitter.com/Agent99Mom/status/1280580456400982016), two of Lisa Heiden’s properties are listed as an address for Ellmax, a company set up by Ghislaine.
Heineken, Mr. Fredie: A Dutch businessman for the Heineken brewing company. Was chairman and CEO from 1971-1989.
Helen and Tim Shifter: Helen is a former Vogue Magazine staffer. Tim is former CEO of LeSportsac and serves as Senior Advisor at Blackstone Group, a private equity firm. The Schifters are personal friends of Ghislaine Maxwell.
Helvin, Marie: Former fashion model and former girlfriend of Imran Khan, the current Prime Minister of Pakistan. According to her memoir, she knows pretty much any popular celebrity from the ‘70s and ‘80s.
Herbert, Jason: Likely a financial adviser based in London.
Hermes, Olga & Olaf: Olaf is a handbag heir. Olga is his ex-wife.
Herrero, Juan & Helen: Juan is like the managing director of an investment bank in Spain.
Hersov, Robert & Kim: Robert is a South African entrepreneur and mining heir who has worked for Goldman Sachs, Morgan Stanley, and News Corp. (owned by Murdoch).. Ex-wife Kim is a London-based fashion editor and designer.
Heseltine, Mr & Mrs: Baron Michael Heseltine is a British businessman and politician who served in various roles in government for British PMs Margaret Thatcher and John Major. Heseltine was a friend of Robert Maxwell, Ghislaine’s father. Heseltine invested in Conservative Parliament member Harvey Proctor’s business after Proctor was forced to resign after it was revealed he had sexual relationships with and took nude pictures of male prostitutes aged 17-21 at his home (source: https://www.independent.co.uk/news/uk/home-news/members-interests-top-tories-lose-on-proctors-shop-the-retailer-1445666.html). At the time, it was illegal to have same-sex relations with prostiutes under the age of 21.
Heseltine, Mr & Mrs: Same as above.
Heseltine, Ms. Annabel: Journalist, columnist, and TV and radio broadcaster. At the age of 22, she became the Assistant-editor for Hong Kong Tatler (there’s that publication again). Daughter of Baron Michael Heseltine.
Heseltine, Rupert: Businessman and heir to Haymarket Media Group. Son of Baron Michael Heseltine.
Hicks, India: A fashion model in the ‘80s and ‘90s, India Hicks is a good friend of Ghislaine Maxwell. Descendant of the Mountbatten family, a British dynasty (although much of their background is German). Granddaughter of the much-decorated war hero, Lord Mountbatten (Prince Charles’s mentor), who, according to FBI files, was “a homosexual with a perversion for young boys” (source: https://www.thesun.co.uk/news/9745399/lord-mountbatten-fbi-dossier-prince-charles/). Prince Charles is her second cousin and Godfather.
Hill, Anthony: Son of Robin Hall, 8th Marquess of Downshire and Juliet Weld-Forester, daughter of 7th Baron Forester. Couldn’t find any more info.
Himmelstein, Howard: Co-owner of clothing brand Camp Beverly Hill and a producescreenwriter.
Hirsch, Jeff: Owner of Foto Care, a shop that sells professional camera equipment. Claims he is only in the ‘Black Book’ because he sold an expensive camera to Ghislaine many years ago and had to go to her house to show her how to use it (source: https://www.miamiherald.com/news/state/florida/article234312632.html). This, however, doesn’t explain why there are two numbers listed under Hirsch’s name that are attributed to Scott Geffert, the General Manager for Advanced Imaging at the MET museum. This could all be innocent or these two could have assisted in Epstein’s hidden camera setup and helped Epstein get high quality pictures of his victims. We can’t be sure.
Hissom, Robert & Andrea: Robert is the founder of Aspen Capital Partners, a large property management firm. He is a friend of Prince Charles. His ex-wife, Andrea, famously got remarried to Steve Wynn, billionaire Las Vegas hotel tycoon. Prince Harry was a guest of Wynn’s at his Encore resort. Andrea and Wynn are close friends of Donald and Melania Trump (source: https://www.pressreader.com/uk/scottish-daily-mail/20120901/281904475353844).
Hoffman, Dustin: Famous Hollywood actor. Hoffman has been accused of sexual assault on multiple occasions, including exposing himself to a minor (source: https://variety.com/2017/biz/news/dustin-hoffman-2-1202641525/)
Hoffman, Hetty: Married to Robin Dundas, Earl of Ronaldshay. Lady Ronaldshay is a patron and ambassador for Zoe’s Place Baby Hospice, a UK-based charity that provides care for terminally ill babies and children up to five years old. A good friend of Ben Holland-Martin (listed just below).
Hoffman, Jessica: Sister of Hetty Hoffman (above), Jessica is an artist and former model who married investment banker Leopoldo Zambeletti. She is a good friend of India Hicks (mentioned above), the granddaughter of Lord Mountbatten (Prince Charles’s mentor), who, according to FBI files, was “a homosexual with a perversion for young boys.”
Holland-Martin, Ben: Works for the National Society for the Prevention of Cruelty to Children (NSPCC). His mother, Rosamund, was chairman of the NSPCC for 20 years while Princess Margaret was President and was involved with the NSPCC for more than 50 years (source: https://www.newspapers.com/image/?clipping_id=36141343&fcfToken=eyJhbGciOiJIUzI1NiIsInR5cCI6IkpXVCJ9.eyJmcmVlLXZpZXctaWQiOjI1OTU4NDE2NSwiaWF0IjoxNTk0MzMwNTQ0LCJleHAiOjE1OTQ0MTY5NDR9.j1V2e0Mr3tJmPzusRYNneLVhUskWiIAvNIjdIpvuzj4). Both Ben and his mother are/were friends of Princess Margaret. Rosamund Holland-Martin (nee Hornby) was related to Charles Hornby, a British socialite and close friend of Prince Charles, who was sentenced to 2 ½ years for luring young runaway boys into prostitution, indecent assault, importuning, and living off the earnings of prostitution (source: https://news.google.com/newspapers?id=0FQ0AAAAIBAJ&sjid=YbkFAAAAIBAJ&pg=4638,2085303). Ben is also good friends with Hetty Hoffman (mentioned above), who is an ambassador for Zoe’s Place Baby Hospice.
Hollond Mr & Mrs James: James is a partner at EFP Capital, an investment and advisory firm. James’s mother married Baron Robert Rothschild after her and James’s father divorced. His now ex-wife, Beatrice, is on many investing firm boards, but most notably, she is a trustee on the Esmee Fairbairn Foundation, a charity that specializes in helping disadvantaged children (source: https://esmeefairbairn.org.uk/beatrice-hollond). If anyone has more info on these two, please post. Epstein has 10 pieces of contact information under their name.
submitted by LearningIsListening to conspiracy [link] [comments]


2020.07.10 04:44 DrFishPhd Every single quote said by Gex

General sayings & quips from Gex when triggered:
Non-triggered quips sorted by world:
Several from the UK version:
submitted by DrFishPhd to copypasta [link] [comments]


2020.07.01 18:22 DevilsDragon Welcome to Devils Dragon

Welcome to Devils Dragon
What is Devil´s Dragon?
The DEVIL´S DRAGON TOKEN (DDGN) is not only a reflection of a practical society that is uniquely designed to sustain peer-to-peer (P2P) engagement or a simple Token enhanced by the ERC-20 Ethereum Blockchain, which enables the development of Decentralised Applications (DApp) that enable transactions to sell, exchange, and trade, it is also a unique multi-use cryptocurrency with many active sites.
Whitepaper: https://www.devilsdragon.com/whitepaper.pdf Website: https://www.devilsdragon.com
(ICO Information / Token Economics)
Token name: DEVIL´S DRAGON Token symbol: DDGN - Token Supply: 180 000 000 NOT MINTABLE Decimals: 18 Token type: ERC20
PRESALE STARTS: 2020-08-15 00:01 ENDS: 2020-08-31 23:59
Token rate 2000 DDGN = 1 ETH for PRIVATE - PRESALE ONLY, in SALE (ITO) RATE will be: 1000 DDGN = 1 ETH
TIME BONUS for PRESALE ONLY Bonus: 50% Date from 2020-08-15 00:01 Date to 2020-08-31 23:59
Community & News Channels
Telegram Official:http://t.me/devilsdragon_official Twitter:https://twitter.com/dragon_devils Discord:https://discord.gg/xCwyntG Reddit:https://www.reddit.com/useDevilsDragon Medium:https://medium.com/@devilsdragon_official Bitcointalk: Coming Soon!
For any kind of business, purpose email us: [[email protected]](mailto:[email protected])
A few of the sites accessible via DDGN are: (Warning, some of them may involve adult material) www.leons.tv www.socialmediacelebs.com www.mywhitewhale.com www.pantyhoseacademy.com

submitted by DevilsDragon to u/DevilsDragon [link] [comments]


2020.07.01 04:33 ShameNap How to parse blocks of text to model using custom serializer

Building an API with DRF. My Model is not very complicated, but the input I get from the front end is literally just an email block of text. I need to parse the raw email input and map it to my model. I have already writen a freestanding python app that can do all the parsing and assign the components to specific variables. What I'm looking for is how to write a custom serializer (I think thats what I need) to parse and map to multiple models (there is a main Email class, then IOC (email addresses, URLs, IPs, attachments, etc in a one to many relationsship). What I don't get is how to start calling functions to start parsing the raw input and populate the instance, as well as create many IOC instances that relate to the initial email I'm creating. Related issue is how do I save stuff to file I don't want to store in the DB, since they can be rather large. My standalone app does it just fine, but in this case, no file ever gets created.

So my models look something like this:
class Email(models.Model):
created = models.DateTimeField(auto_now_add=True)
# TODO need to save raw as a file not a db field
email_raw = models.CharField(max_length=1000, blank=True, default='')
hash_id = models.CharField(max_length=64, blank=True, default='')
header_to = models.CharField(max_length=100, blank=True, default='')
header_from = models.CharField(max_length=100, blank=True, default='')
header_reply_to = models.CharField(max_length=100, blank=True, default='')
header_return_path = models.CharField(max_length=100, blank=True, default='')
header_subject = models.CharField(max_length=100, blank=True, default='')
header_date = models.CharField(max_length=100, blank=True, default='2020-01-01')
header_message_id = models.CharField(max_length=100, blank=True, default='')
header_rcvd1 = models.CharField(max_length=100, blank=True, default='')
header_rcvd2 = models.CharField(max_length=100, blank=True, default='')
header_rcvd3 = models.CharField(max_length=100, blank=True, default='')
header_rcvd4 = models.CharField(max_length=100, blank=True, default='')
header_rcvd5 = models.CharField(max_length=100, blank=True, default='')
file_location = models.CharField(max_length=128, blank=True, default='')
score = models.SmallIntegerField(default=-1)
class Meta:
ordering = ['created']
class IOC(models.Model):
DATA_TYPE = (
('ip', 'IP'),
('domain', 'Domain'),
('url', 'URL'),
('email', 'Email Address'),
('md5_hash', 'MD5'),
('sha256_hash', 'SHA 256'),
('file', 'File'),
)
created = models.DateTimeField(auto_now_add=True)
# Source and score need to split out to a different class. 1 IOC can be scored a bunch of different ways, but leave score in to provide overall score
source = models.CharField(max_length=32)
term = models.CharField(max_length=256)
ioc_type = models.CharField(max_length=16)
score = models.SmallIntegerField(default=-1)
md5 = models.CharField(max_length=32, blank=True, default='')
sha256 = models.CharField(max_length=64, blank=True, default='')
file_location = models.CharField(max_length=128, blank=True, default='')
email = models.ForeignKey(Email, on_delete=models.SET_DEFAULT, default=-1)
class Meta:
ordering = ['created']

And my serializer looks something like this:
class EmailSerializer(serializers.Serializer):
pk = serializers.IntegerField(read_only=True)
header_to = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_from = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_reply_to = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_return_path = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_rcvd1 = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_rcvd2 = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_rcvd3 = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_rcvd4 = serializers.CharField(required=False, allow_blank=True, max_length=100)
header_rcvd5 = serializers.CharField(required=False, allow_blank=True, max_length=100)
def _extract_urls(self, text):
''' function to extract all URLs from a block of text '''
response = []
regex = r"(?i)\b((?:https?://www\d{0,3}[.][a-z0-9.\-]+[.][a-z]{2,4}/)(?:[^\s()<>]+\(([^\s()<>]+(\([^\s()<>]+\)))*\))+(?:\(([^\s()<>]+(\([^\s()<>]+\)))*\)[^\s\!()[]{};:'\".,<>?«»“”‘’]))"`
urls = re.findall(regex,text)
for url in urls:
parsed_url = urllib.parse.urlsplit(url[0])
partial_url = parsed_url.scheme + "://" + parsed_url.netloc + "/" + parsed_url.path
response.append(parsed_url.netloc + parsed_url.path)
return response
def _extract_domains(self, text):
''' function to extract all domains from a block of text '''
response = []
regex = r"""(?i)\b((?:https?:(?:/{1,3}[a-z0-9%])[a-z0-9.\-]+[.](?:comnetorgedugovmilaeroasiabizcatcoopinfointjobsmobimuseumnamepostproteltravelxxxacadaeafagaialamanaoaqarasatauawaxazbabbbdbebfbgbhbibjbmbnbobrbsbtbvbwbybzcacccdcfcgchcickclcmcncocrcscucvcxcyczdddedjdkdmdodzeceeegehereseteufifjfkfmfofrgagbgdgegfggghgiglgmgngpgqgrgsgtgugwgyhkhmhnhrhthuidieiliminioiqirisitjejmjojpkekgkhkikmknkpkrkwkykzlalblclilklrlsltlulvlymamcmdmemgmhmkmlmmmnmompmqmrmsmtmumvmwmxmymznancnenfngninlnonpnrnunzompapepfpgphpkplpmpnprpsptpwpyqarerorsrurwsasbscsdsesgshsisjJaskslsmsnsosrssstsusvsxsysztctdtftgthtjtktltmtntotptrtttvtwtzuaugukusuyuzvavcvevgvivnvuwfwsyeytyuzazmzw)/)(?:[^\s()<>{}\[\]]+\([^\s()]*?\([^\s()]+\)[^\s()]*?\)\([^\s]+?\))+(?:\([^\s()]*?\([^\s()]+\)[^\s()]*?\)\([^\s]+?\)[^\s\!()[]{};:'".,<>?«»“”‘’])(?:(? urls = re.findall(regex,text)
for url in urls:
if url is not None and url != '':
response.append({ 'term': url, 'ioc_type': 'url', 'md5': '', 'sha256': '', 'file_location': '', 'score': -1 })
return response
def _extract_emails(self, text):
''' function to extract any email addresses froma block of text '''
response = []
regex = r'(?:\.?)([\w\-_+#~!$&\'\.]+(?
matches = re.findall(regex, text)
get_first_group = lambda y: list(map(lambda x: x[0], y))
email_addresses = get_first_group(matches)
email_addresses = list(set(email_addresses))
for addy in email_addresses:
response.append({ 'term': addy, 'ioc_type': 'email', 'md5': '', 'sha256': '', 'file_location': '', 'score': -1 })
return response
def _extract_ips(self, text):
response = []
regex = r"(?:(?:1\d\d2[0-5][0-5]2[0-4]\d0?[1-9]\d0?0?\d)\.){3}(?:1\d\d2[0-5][0-5]2[0-4]\d0?[1-9]\d0?0?\d)"
matches = re.findall(regex, text)
# TODO remove static IP below, just there for testing
matches.append("116.68.197.190")
for m in matches:
reponse.append({ 'term': m, 'ioc_type': 'ip', 'md5': '', 'sha256': '', 'file_location': '', 'score': -1 })
return response
# internal variables
id_hash = ''
id_dict = {}
headers = []
iocs = []
def _parse_email(self, email_raw):
message = email.message_from_string(raw, policy=policy.default)
# for messages that come from internal mailbox, e.g [email protected], then strip off the outer layer
# might not need to do this if we lose all the headers...
if forwarded == True:
# then we need to strip off the top layer if it is multipart
if message.is_multipart():
# strip off top layer since it was forwarded to us
# TODO figure out how to strip off last forwarding of email
pass
# PARSE THE EMAIL FIRST, THEN DO ANALYSIS
for k,v in message.items():
print(k,v)
# grab some fields to create a unique id
if k == "Date" or k == "Message-ID" or k == "From" or k == "To" or k == "Subject":
self.id_dict[k] = v
# parse important header first
if k == "Return-Path" or k == "Reply-To" or k == "From":
# It's a header, grab it
self.headers.append({k:v.strip('<>')})
elif k == "Received":
self.headers.append({k:v})
# extract all emails and IPs from headers
self._extract_email_part(v)
# hash fields together for a unique (I hope) id
id_str = self.id_dict['To'] + self.id_dict['From'] + self.id_dict['Subject'] + self.id_dict['Date'] + self.id_dict['Message-ID']
id_str = id_str.encode('ascii', errors='replace')
self.id_hash = hashlib.sha256(id_str).hexdigest()
if message.is_multipart() == True:
for part in message.walk():
if part.is_attachment() == True:
# prepend Content-ID to filename to make sure filename is unique
# maybe can also use as a reference to map attachments to emails, but not sure how unique content-id is outside of a single email
filename = part['Content-ID'].strip("<>") + "_" + part.get_filename()
fp = open(filename, 'wb')
fp.write(part.get_payload(decode=True))
fp.close()
# generate hashes
md5_hash = hashlib.md5()
the_file = open(filename, "rb")
contents = the_file.read()
md5_digest = hashlib.md5(contents).hexdigest()
sha256_digest = hashlib.sha256(contents).hexdigest()
the_file.close()
iocs.append({ 'ioc_type': 'file', 'file_location': filename, 'sha256': sha256_digest, 'md5': md5_digest, 'score': -1 })
else:
for k,v in part.items():
# extract all emails from headers
self._extract_email_part(v)
else:
print("## main message is not multipart ##")
# print("Attachment ?:", part.is_attachment())
print(" Type:", message.get_content_type())
print(" Disp:", message.get_content_disposition())
self._extract_email_part(message.as_string())
# Done parsing
# dedupe lists by converting to set and back to list
self.mta_ips = list(set(self.mta_ips))
self.extracted_ips = list(set(self.extracted_ips))
self.extracted_urls = list(set(self.extracted_urls))
self.extracted_domains = list(set(self.extracted_domains))
self.extracted_emails = list(set(self.extracted_emails))
# self.attachments = list(set(self.attachments))
return None
submitted by ShameNap to django [link] [comments]


2020.06.19 14:48 Nelabaiss TWRP backup file grows massively

Hello! When I try to transfer my ~6 GB TWRP backup file from my phone's SD card to PC, the filesize suddenly grows to 90 GB, which is more than my total phone storage. I have a Redmi 4X phone with LineageOS 16.0 and TWRP 3.3.1.
Not sur eif important, but when I boot to TWRP, TWRP says "Unable to mount storage" but evetything seems to work fine.
Any help or advice would be appreciated. TWRP log file below:
Starting TWRP 3.3.1-0-ae7ff3b2 on Sun Jun 28 03:19:58 1970 (pid 395)RECOVERY_SDCARD_ON_DATA := trueI:Lun file '/sys/class/android_usb/android0/f_mass_storage/lun0/file' does not exist, USB storage mode disabledTW_INCLUDE_CRYPTO := trueI:TW_BRIGHTNESS_PATH := /sys/class/leds/lcd-backlight/brightnessI:Found brightness file at '/sys/class/leds/lcd-backlight/brightness'I:TWFunc::Set_Brightness: Setting brightness control to 255I:LANG: enStarting the UI...setting DRM_FORMAT_RGBX8888 and GGL_PIXEL_FORMAT_RGBX_8888cannot find/open a drm device: No such file or directoryfb0 reports (possibly inaccurate): vi.bits_per_pixel = 32 vi.red.offset = 0 .length = 8 vi.green.offset = 8 .length = 8 vi.blue.offset = 16 .length = 8setting GGL_PIXEL_FORMAT_RGBA_8888double bufferedframebuffer: 0 (720 x 1280)Using fbdev graphics.TW_SCREEN_BLANK_ON_BOOT := trueI:TWFunc::Set_Brightness: Setting brightness control to 255I:Loading package: splash (/twres/splash.xml)I:Load XML directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/splash.xml' directlyI:Checking resolution...I:Scaling theme width 0.666667x and height 0.666667x, offsets x: 0 y: 0 w: 0 h: 0I:Loading resources...I:Loading variables...I:Loading mouse cursor...I:Loading pages...I:Loading page splashI:Switching packages (splash)I:Blacklisting input device: hbtp_vmI:minui: /sys/board_properties/virtualkeys.ft5x06_720p is 4 % 6I:minui: /sys/board_properties/virtualkeys.ft5x06_720p: ignoring unknown virtual key type 172=> Linking mtab=> Processing /etc/twrp.fstabI:Reading /etc/twrp.fstabI:Processing '/system'I:Processing '/system_image'I:Processing '/vendor'I:Processing '/vendor_image'I:Processing '/data'I:Processing '/cache'I:Processing '/persist'I:Created '/persist' folder.I:Attempt to load settings from /persist settings file...I:InfoManager loading from '/persist/.twrps'.__bionic_open_tzdata: couldn't find any tzdata when looking for SAUST-3SAUDT!__bionic_open_tzdata: couldn't find any tzdata when looking for posixrules!I:TWFunc::Set_Brightness: Setting brightness control to 255I:TWFunc::Fixup_Time: Pre-fix date and time: 1970-06-28--07-19-58I:TWFunc::Fixup_Time: Setting time offset from file /sys/class/rtc/rtc0/since_epochI:TWFunc::Fixup_Time: will attempt to use the ats files now.I:TWFunc::Fixup_Time: Setting time offset from file /persist/time/ats_2, offset 1559278594647I:TWFunc::Fixup_Time: Date and time corrected: 2019-11-25--11-16-32I:Processing '/boot'I:Processing '/recovery'I:Processing '/misc'I:Processing '/efs1'I:Processing '/efs2'I:Processing '/firmware'I:Created '/firmware' folder.I:Processing '/external_sd'I:Created '/external_sd' folder.I:Processing '/usb-otg'I:Created '/usb-otg' folder.I:Done processing fstab filesI:Setting up '/data' as data/media emulated storage.I:Can't probe device /dev/block/mmcblk0p49I:Unable to mount '/data'I:Actual block device: '/dev/block/mmcblk0p49', current file system: 'ext4'I:Can't probe device /dev/block/mmcblk0p49I:Unable to mount '/data'I:Actual block device: '/dev/block/mmcblk0p49', current file system: 'ext4'I:Backup folder set to '/data/media/TWRP/BACKUPS/68050087d340'I:Settings storage is '/data/media'Updating partition details...I:Unable to mount '/usb-otg'I:Actual block device: '', current file system: 'vfat'...doneUnable to mount storageI:Unmounting main partitions...Partition Logs:/system /dev/block/mmcblk0p24 Size: 3023MB Used: 1522MB Free: 1501MB Backup Size: 1522MB Flags: Can_Be_Mounted Can_Be_Wiped Can_Be_Backed_Up Wipe_Available_in_GUI IsPresent Mount_Read_Only Primary_Block_Device: /dev/block/mmcblk0p24 Display_Name: System Storage_Name: System Backup_Path: /system Backup_Name: system Backup_Display_Name: System Storage_Path: /system Current_File_System: ext4 Fstab_File_System: ext4 Backup_Method: files/system_image /dev/block/mmcblk0p24 Size: 3072MB Flags: Can_Be_Backed_Up IsPresent Can_Flash_Img Primary_Block_Device: /dev/block/mmcblk0p24 Display_Name: System Image Storage_Name: system_image Backup_Path: /system_image Backup_Name: system_image Backup_Display_Name: System Image Storage_Path: /system_image Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/vendor /dev/block/mmcblk0p48 Size: 503MB Used: 226MB Free: 277MB Backup Size: 226MB Flags: Can_Be_Mounted Can_Be_Wiped Wipe_Available_in_GUI IsPresent Mount_Read_Only Primary_Block_Device: /dev/block/mmcblk0p48 Display_Name: Vendor Storage_Name: Vendor Backup_Path: /vendor Backup_Name: vendor Backup_Display_Name: Vendor Storage_Path: /vendor Current_File_System: ext4 Fstab_File_System: ext4 Backup_Method: files/vendor_image /dev/block/mmcblk0p48 Size: 512MB Flags: Can_Be_Backed_Up IsPresent Can_Flash_Img Primary_Block_Device: /dev/block/mmcblk0p48 Display_Name: Vendor Image Storage_Name: vendor_image Backup_Path: /vendor_image Backup_Name: vendor_image Backup_Display_Name: Vendor Image Storage_Path: /vendor_image Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/data /dev/block/mmcblk0p49 Size: 0MB Flags: Can_Be_Wiped Can_Be_Backed_Up Wipe_During_Factory_Reset Wipe_Available_in_GUI IsPresent Can_Be_Encrypted Is_Encrypted Has_Data_Media Can_Encrypt_Backup Use_Userdata_Encryption Is_Storage Is_Settings_Storage Symlink_Path: /data/media Symlink_Mount_Point: /sdcard Primary_Block_Device: /dev/block/mmcblk0p49 Crypto_Key_Location: footer Display_Name: data Storage_Name: Internal Storage Backup_Path: /data Backup_Name: data Backup_Display_Name: Data Storage_Path: /data/media Current_File_System: emmc Fstab_File_System: ext4 Backup_Method: dd MTP_Storage_ID: 65537/cache /dev/block/mmcblk0p25 Size: 231MB Used: 0MB Free: 231MB Backup Size: 0MB Flags: Can_Be_Mounted Can_Be_Wiped Can_Be_Backed_Up Wipe_During_Factory_Reset Wipe_Available_in_GUI IsPresent Primary_Block_Device: /dev/block/mmcblk0p25 Display_Name: Cache Storage_Name: Cache Backup_Path: /cache Backup_Name: cache Backup_Display_Name: Cache Storage_Path: /cache Current_File_System: ext4 Fstab_File_System: ext4 Backup_Method: files/persist /dev/block/mmcblk0p26 Size: 26MB Used: 1MB Free: 25MB Backup Size: 1MB Flags: Can_Be_Mounted Can_Be_Wiped Can_Be_Backed_Up IsPresent Primary_Block_Device: /dev/block/mmcblk0p26 Display_Name: Persist Storage_Name: Persist Backup_Path: /persist Backup_Name: persist Backup_Display_Name: Persist Storage_Path: /persist Current_File_System: ext4 Fstab_File_System: ext4 Backup_Method: files/boot /dev/block/mmcblk0p21 Size: 64MB Flags: Can_Be_Backed_Up IsPresent Can_Flash_Img Primary_Block_Device: /dev/block/mmcblk0p21 Display_Name: Boot Storage_Name: boot Backup_Path: /boot Backup_Name: boot Backup_Display_Name: Boot Storage_Path: /boot Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/recovery /dev/block/mmcblk0p22 Size: 64MB Flags: Can_Be_Backed_Up IsPresent Can_Flash_Img Primary_Block_Device: /dev/block/mmcblk0p22 Display_Name: Recovery Storage_Name: recovery Backup_Path: /recovery Backup_Name: recovery Backup_Display_Name: Recovery Storage_Path: /recovery Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/misc /dev/block/mmcblk0p27 Size: 1MB Flags: IsPresent Primary_Block_Device: /dev/block/mmcblk0p27 Display_Name: misc Storage_Name: misc Backup_Path: /misc Backup_Name: misc Backup_Display_Name: misc Storage_Path: /misc Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/efs1 /dev/block/mmcblk0p13 Size: 1MB Flags: Can_Be_Backed_Up Has_SubPartition IsPresent Primary_Block_Device: /dev/block/mmcblk0p13 Display_Name: EFS Storage_Name: EFS Backup_Path: /efs1 Backup_Name: efs1 Backup_Display_Name: EFS Storage_Path: /efs1 Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/efs2 /dev/block/mmcblk0p14 Size: 1MB Flags: Can_Be_Backed_Up Is_SubPartition IsPresent SubPartition_Of: /efs1 Primary_Block_Device: /dev/block/mmcblk0p14 Display_Name: efs2 Storage_Name: efs2 Backup_Path: /efs2 Backup_Name: efs2 Backup_Display_Name: efs2 Storage_Path: /efs2 Current_File_System: emmc Fstab_File_System: emmc Backup_Method: dd/firmware /dev/block/mmcblk0p1 Size: 83MB Used: 82MB Free: 1MB Backup Size: 82MB Flags: Can_Be_Mounted Can_Be_Wiped IsPresent Mount_To_Decrypt Primary_Block_Device: /dev/block/mmcblk0p1 Display_Name: Firmware Storage_Name: Firmware Backup_Path: /firmware Backup_Name: firmware Backup_Display_Name: Firmware Storage_Path: /firmware Current_File_System: vfat Fstab_File_System: vfat Backup_Method: files/external_sd /dev/block/mmcblk1p1 Size: 14875MB Used: 5765MB Free: 9110MB Backup Size: 5765MB Flags: Can_Be_Mounted Can_Be_Wiped Wipe_Available_in_GUI Removable IsPresent Is_Storage Primary_Block_Device: /dev/block/mmcblk1p1 Alternate_Block_Device: /dev/block/mmcblk1 Display_Name: Micro SDCard Storage_Name: Micro SDCard Backup_Path: /external_sd Backup_Name: external_sd Backup_Display_Name: Micro SDCard Storage_Path: /external_sd Current_File_System: vfat Fstab_File_System: vfat Backup_Method: files MTP_Storage_ID: 65538/usb-otg Size: 0MB Used: 0MB Free: 0MB Backup Size: 0MB Flags: Can_Be_Mounted Can_Be_Wiped Wipe_Available_in_GUI Removable Is_Storage Primary_Block_Device: /dev/block/sda1 Alternate_Block_Device: /dev/block/sda Display_Name: USB OTG Storage_Name: USB OTG Backup_Path: /usb-otg Backup_Name: usb-otg Backup_Display_Name: USB OTG Storage_Path: /usb-otg Current_File_System: vfat Fstab_File_System: vfat Backup_Method: files MTP_Storage_ID: 65539I:Loading package: TWRP (/twres/ui.xml)I:Load XML directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/zh_TW.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/zh_CN.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/uk.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/tr.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/sv.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/sl.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/sk.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/ru.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/pt_PT.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/pt_BR.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/pl.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/nl.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/ja.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/it.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/hu.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/fr.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/es.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/en.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/el.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/de.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/cz.xml' directlyI:PageManager::LoadFileToBuffer loading filename: '/twres/languages/en.xml' directlyparsing languageFileparsing languageFile doneI:PageManager::LoadFileToBuffer loading filename: '/twres/ui.xml' directlyI:Checking resolution...I:Scaling theme width 0.666667x and height 0.666667x, offsets x: 0 y: 0 w: 0 h: 0I:Loading resources...I:Failed to load image from indeterminate013, error -1I:Loading variables...I:Loading mouse cursor...I:Loading pages...I:Including file: /twres/portrait.xml...I:PageManager::LoadFileToBuffer loading filename: '/twres/portrait.xml' directlyI:Loading resources...I:Loading variables...I:Loading mouse cursor...I:Loading pages...I:Loading page mainI:Loading page main2I:Loading page installI:Loading page flash_confirmI:Loading page flash_zipI:Loading page flash_doneI:Loading page flash_sleep_and_rebootI:Loading page flashimage_confirmI:Loading page clear_varsI:Loading page reboot_system_routineI:Loading page confirm_actionI:Loading page action_pageI:Loading page singleaction_pageI:Loading page action_completeI:Loading page filecheckI:Loading page rebootcheckI:Loading page appcheckI:Loading page wipeI:Loading page advancedwipeI:Loading page formatdataI:Loading page formatdata_confirmI:Loading page checkpartitionlistI:Loading page partitionoptionsI:Loading page refreshfilesystemI:Loading page selectfilesystemI:Loading page backupI:Loading page backup_optionsI:Loading page backupname1I:Loading page backupname2I:Loading page backupencryptionI:Loading page backupencryption2I:Loading page checkbackuppasswordI:Loading page backup_runI:Loading page restoreI:Unable to open '/data/media/TWRP/BACKUPS/68050087d340'I:Loading page restore_readI:Loading page restore_decryptI:Loading page try_restore_decryptI:Loading page restore_selectI:Loading page renamebackupI:Loading page restore_runI:Loading page mountI:Loading page usb_mountI:Loading page usb_umountI:Loading page system_readonly_checkI:Loading page rebootI:Loading page rebootappI:Loading page system_readonlyI:Loading page settingsI:Loading page settings_timezoneI:Loading page settings_screenI:Loading page settings_vibrationI:Loading page settings_languageI:Loading page copylogI:Loading page advancedI:Loading page partsdcardselI:Loading page partsdcardcheckI:Loading page partsdcardI:Loading page htcdumlockI:Loading page repackselectI:Loading page repackconfirmI:Loading page lockI:Loading page filemanagerlistI:Loading page filemanageroptionsI:Loading page choosedestinationfolderI:Loading page filemanagerrenamefileI:Loading page filemanagerrenamefolderI:Loading page filemanagerchmodI:Loading page filemanagerconfirmI:Loading page filemanageractionI:Loading page decryptI:Loading page decrypt_patternI:Loading page trydecryptI:Loading page terminalcommandI:Loading page sideloadI:Loading page fixcontextsI:Loading page slideoutI:Loading page select_storageI:Loading page select_languageI:Switching packages (TWRP)Startup Commands: ro.boottime.adbd=4279210726ro.boottime.init=3846ro.boottime.init.selinux=116ro.boottime.init.cold_boot_wait=262ro.boottime.ueventd=3995975310ro.boottime.recovery=4277500674ro.boottime.set_permissive=4276539320ro.config.ringtone=omni_ringtone1.ogg,omni_ringtone1.oggro.config.alarm_alert=omni_alarm1.oggro.config.notification_sound=omni_notification1.oggro.dalvik.vm.native.bridge=0dalvik.vm.isa.arm.variant=cortex-a53dalvik.vm.isa.arm.features=defaultdalvik.vm.isa.arm64.variant=genericdalvik.vm.isa.arm64.features=defaultdalvik.vm.dexopt.secondary=truedalvik.vm.usejit=truedalvik.vm.lockprof.threshold=500dalvik.vm.dex2oat-Xms=64mdalvik.vm.dex2oat-Xmx=512mdalvik.vm.appimageformat=lz4dalvik.vm.usejitprofiles=truedalvik.vm.stack-trace-dir=/data/anrdalvik.vm.image-dex2oat-Xms=64mdalvik.vm.image-dex2oat-Xmx=64mdalvik.vm.image-dex2oat-filter=verify-at-runtimedalvik.vm.dex2oat-minidebuginfo=truedebug.atrace.tags.enableflags=0ro.art.hiddenapi.warning=1ro.com.google.clientidbase=android-googlero.com.android.dataroaming=falsero.com.android.wifi-watchlist=GoogleGuestro.opa.eligible_device=truero.url.legal=http://www.google.com/intl/%s/mobile/android/basic/phone-legal.htmlro.boot.emmc=truero.boot.mode=recoveryro.boot.selinux=permissivero.boot.baseband=msmro.boot.hardware=qcomro.boot.keymaster=1ro.boot.bootdevice=7824900.sdhciro.boot.veritymode=enforcingro.boot.verifiedbootstate=orangero.omni.device=santoniro.omni.version=9-20190623-santoni-HOMEMADEro.twrp.boot=1ro.twrp.version=3.3.1-0ro.vndk.lite=truero.vndk.version=28ro.wifi.channels=ro.allow.mock.location=1ro.board.platform=msm8937ro.build.id=PQ3A.190605.003ro.build.date=Sun Jun 23 17:06:24 UTC 2019ro.build.date.utc=1561309584ro.build.host=27a846b0703aro.build.tags=test-keysro.build.type=engro.build.user=jenkinsro.build.flavor=omni_santoni-engro.build.display.id=omni_santoni-eng 9 PQ3A.190605.003 1 test-keysro.build.product=santoniro.build.selinux=1ro.build.version.sdk=28ro.build.version.base_os=ro.build.version.release=9ro.build.version.codename=RELro.build.version.incremental=1ro.build.version.preview_sdk=0ro.build.version.release_orig=9ro.build.version.all_codenames=RELro.build.version.security_patch=2019-06-05ro.build.version.security_patch_orig=2019-06-05ro.build.version.min_supported_target_sdk=17ro.build.description=omni_santoni-eng 9 PQ3A.190605.003 1 test-keysro.build.characteristics=defaultro.bionic.ld.warning=1ro.kernel.android.checkjni=1ro.secure=0ro.treble.enabled=falsero.zygote=zygote32ro.carrier=unknownro.product.cpu.abi=arm64-v8aro.product.cpu.abilist=armeabi-v7a,armeabiro.product.cpu.abilist32=armeabi-v7a,armeabiro.product.cpu.abilist64=ro.product.name=omni_santoniro.product.brand=Xiaomiro.product.model=Redmi 4ro.product.device=santoniro.product.locale=en-USro.product.manufacturer=Xiaomiro.baseband=msmro.bootmode=recoveryro.hardware=qcomro.revision=0ro.services.whitelist.packagelist=com.google.android.gmsro.bootimage.build.date=Sun Jun 23 17:06:24 UTC 2019ro.bootimage.build.date.utc=1561309584ro.bootimage.build.fingerprint=Xiaomi/omni_santoni/santoni:9/PQ3A.190605.003/1:eng/test-keysro.bootloader=unknownro.debuggable=1ro.modversion=OmniROM-9-20190623-santoni-HOMEMADEro.setupwizard.enterprise_mode=1ro.property_service.version=2ro.control_privapp_permissions=enforcero.actionable_compatible_property.enabled=falseinit.svc.adbd=runninginit.svc.ueventd=runninginit.svc.recovery=runninginit.svc.set_permissive=stoppedtwrp.crash_counter=0keyguard.no_require_sim=truetombstoned.max_tombstone_count=50sys.usb.ffs.ready=1ro.build.fingerprint=Xiaomi/omni_santoni/santoni:9/PQ3A.190605.003/1:eng/test-keyslog.tag.stats_log=Iro.logd.size.stats=64Kro.persistent_properties.ready=truepm.dexopt.boot=extractpm.dexopt.ab-ota=speed-profilepm.dexopt.shared=speedpm.dexopt.install=speed-profilepm.dexopt.inactive=verifypm.dexopt.bg-dexopt=speed-profilepm.dexopt.first-boot=extractro.boot.serialno=68050087d340ro.serialno=68050087d340service.adb.root=1net.bt.name=Androidnet.tethering.noprovisioning=truesys.usb.controller=msm_hsusbpersist.sys.usb.config=adbpersist.sys.dalvik.vm.lib.2=libart.sopersist.sys.disable_rescue=trueI:Is encrypted, do decrypt page firstI:Switching packages (TWRP)I:Set page: 'decrypt'I:Set page: 'trydecrypt'I:operation_start: 'Decrypt'D:crypt_ftr->fs_size = 51370927I:starting verify_hw_fde_passwdI:Using scrypt with keymaster for cryptfs KDFI:TWRP keymaster max API: 4I:Signing safely-padded objectkeymaster module name is Keymaster QTI HALkeymaster version is 256Found keymaster1 module, using keymaster1 API.I:Extra parameters for dm_crypt: fde_enabled iceI:target_type = req-cryptI:real_blk_name = /dev/block/mmcblk0p49, extra_params = fde_enabled iceE:test mount returned 0I:Found no matching fstab entry for uevent device '/devices/virtual/block/dm-0' - addI:Found no matching fstab entry for uevent device '/devices/virtual/block/dm-0' - changeData successfully decrypted, new block device: '/dev/block/dm-0'I:mount -o bind '/data/media' '/sdcard' process ended with RC=0I:Backup folder set to '/data/media/0/TWRP/BACKUPS/68050087d340'Updating partition details...I:mount -o bind '/data/media/0' '/sdcard' process ended with RC=0I:Data backup size is 4876MB, free: 13418MB.I:Unable to mount '/usb-otg'I:Actual block device: '', current file system: 'vfat'...doneI:mount -o bind '/data/media/0' '/sdcard' process ended with RC=0/data /dev/block/dm-0 Size: 24561MB Used: 4876MB Free: 13418MB Backup Size: 4876MB Flags: Can_Be_Mounted Can_Be_Wiped Can_Be_Backed_Up Wipe_During_Factory_Reset Wipe_Available_in_GUI IsPresent Can_Be_Encrypted Is_Encrypted Is_Decrypted Has_Data_Media Can_Encrypt_Backup Use_Userdata_Encryption Is_Storage Is_Settings_Storage Symlink_Path: /data/media/0 Symlink_Mount_Point: /sdcard Primary_Block_Device: /dev/block/mmcblk0p49 Decrypted_Block_Device: /dev/block/dm-0 Crypto_Key_Location: footer Display_Name: data Storage_Name: Internal Storage Backup_Path: /data Backup_Name: data Backup_Display_Name: Data Storage_Path: /data/media/0 Current_File_System: ext4 Fstab_File_System: ext4 Backup_Method: files MTP_Storage_ID: 65537I:Unmounting main partitions...tw_get_context got selinux context: u:object_r:media_rw_data_file:s0I:Got default contexts and file mode for storage files.I:Decrypt adopted storage startingI:PageManager::LoadFileToBuffer loading filename: '/data/system/storage.xml' directlyI:successfully loaded storage.xmlI:Set page: 'main'I:Set page: 'clear_vars'I:Set page: 'main2'I:operation_end - status=0I:Set page: 'main'I:Set page: 'clear_vars'I:Set page: 'main2'SELinux contexts loaded from /file_contextsFull SELinux support is present.I:Switching packages (TWRP)I:Copying file /cache/recovery/log to /cache/recovery/last_logI:Attempt to load settings from settings file...I:InfoManager loading from '/data/media/0/TWRP/.twrps'.I:Backup folder set to '/data/media/0/TWRP/BACKUPS/68050087d340'I:Copying file /etc/recovery.fstab to /cache/recovery/recovery.fstabI:Version number saved to '/cache/recovery/.version'I:Unable to mount '/usb-otg'I:Actual block device: '', current file system: 'vfat'I:TWFunc::Set_Brightness: Setting brightness control to 255I:PageManager::LoadFileToBuffer loading filename: '/twres/languages/en.xml' directlyparsing languageFileparsing languageFile doneI:Translating partition display namesI:Backup folder set to '/data/media/0/TWRP/BACKUPS/68050087d340'I:Starting MTPI:[MTP] Starting MTPI:sending message to add 65537 '/data/media/0' 'Internal Storage'I:Message sent, add storage ID: 65537 '/data/media/0'I:sending message to add 65538 '/external_sd' 'Micro SD card'I:Message sent, add storage ID: 65538 '/external_sd'MTP EnabledI:Check_Lifetime_Writes result: '464485'I:Switching packages (TWRP)I:Starting Adb Backup FIFOI:Set page: 'main'I:Set page: 'clear_vars'I:Set page: 'main2'I:[MTP] created new mtpserver objectI:[MTP] mtppipe add storage 65537 '/data/media/0'E:[MTP] Failed to start usb driver!I:[MTP] mtppipe add storage 65538 '/external_sd'I:Set page: 'advanced'I:Set page: 'copylog'I:Set page: 'action_page'I:operation_start: 'Copy Log'I:Copying file /tmp/recovery.log to /data/media/0/recovery.log 

submitted by Nelabaiss to androidroot [link] [comments]


2020.06.14 12:31 Bahlor Guerilla Collective Day 2

Guerilla Collective Day 2
Teaser trailer of the event Teaser for day 2 (only Twitter video, no YT version found)
Today will be the second day (of three) of the Guerilla Collective event. It is not directly related to Stadia, but may feature games coming to Stadia.
Yesterday was a bit disappointing as there weren't many Stadia appearances. Let's hope we have more luck today and also fingers crossed that it's "just" another case of Stada logo missing, but actually coming... not that I see any reason for this but it's a thing it seems...
But at least we got an estimate date for the early access of Baldurs Gate 3, which will happen - maybe - in August 2020. We're also getting more gameplay on June 18th! (src). Larian Studios will be present with Divinity: Original Sin 2 today, fingers crossed for a Stadia announcement.
When will it start?
9am PST 6pm CET (when this post is ~5.5 hrs old)
Where can I watch it?
Twitch.tv YouTube by GameSpot YouTube by IGN
What will be shown?
While we don't know what exactly what will be shown, some stuff is known:
Official Website
If there is something missing or wrong, please let me know in the comments
EDIT: Changed a bit of text, based on a suggestion by marren17
EDIT: Changed text, thanks to PilksUK
submitted by Bahlor to Stadia [link] [comments]


2020.06.12 19:02 -JaguarWong- The Novelist (PC) - Gaming the Pandemic: Day 81

My ongoing efforts to play one title from my 553 game backlog for every day that the UK is in lockdown...

The Novelist for the PC

Previous days' games are linked in my profile

In a roundabout sort of way the indie game blow up of a few years ago is a large part of the reason why my backlog is quite so big as it is.
Back then, when the boom was fully booming, my trusty laptop was suddenly unable to play the kind of small independently produced games that weren’t available on consoles.
With the success of Xbox Live and PSN smaller games were getting more attention, XBLIG saw even smaller games get some of the spotlight, and by the time Nintendo embraced this market with it’s ‘Nindies’ showcase coverage of small, arty, games with development teams whose number you could count on one hand were as important to traffic on most games websites as that of the latest COD or [insert name of competitive multiplayer game no-one really cares about].
So to continue playing indie games that weren’t coming to console, or were but at a much later date or hugely inflated price, I had to join the Glorious PC Gaming Master Race.
I often wonder if people who seriously profess to be part of the Glorious PC Gaming Master Race understand that the name ‘Glorious PC Gaming Master Race’ was actually coined ironically? And that by continuing to describe themselves as members of the Glorious PC Gaming Master Race they are only further highlighting the ridiculous attitudes that the name ‘Glorious PC Gaming Master Race’ was making fun of?
What am I saying…? Of course they know… Right?
Anyway, I bought a PC which meant, at the time, getting games from Steam, which meant Steam sales and Humble Bundles, which meant a huge backlog of games I bought for 50p and never played.
I’ve got in the habit now of regularly ‘Marie Kondo’-ing my digital games but, despite regular pruning, they still make up a sizable chunk of my collection and my backlog.
What was I talking about again? Oh right! The Novelist. The Novelist was one such game.

This is a game where you play as an unnamed, un-shown entity that either lives in, or ‘is’ a modernist clifftop house somewhere in America.
Throughout the course of the game it’s your task to guide the Kaplans, a nuclear family of three, in decisions that will affect their lives during their three month stay and beyond.
This is a game that involves a lot of reading. The central mechanic is that you move around the house, observe the family, read their thoughts, and choose the best course of action for them at the end of each day.
You can either move through the house in the usual way for first person games or you can zip about by ‘possessing’ light fittings. As you do this you’ll notice clues and story prompts that you can investigate to advance the plot - and they are always letters, magazines, or journal entries.
Even in the game’s most important mechanic, whereby you explore the memories of the family members, the memories are almost always of them writing or reading something.
Fortunately, for my sanity and enjoyment of the game, it’s by-and-large very well written and voice acted. There are a fair few tropes in the midst of quite a lot of angst (Why can no-one in fiction ever just enjoy the occasional drink?) but these are outweighed by some genuinely nice wordsmithery - certainly better than the usual video game nonsense.
Having read the family’s journals, letters, shopping list, minds, etc you have to choose whose needs are greatest. Is the father's book more important than the mother's art and the child’s happiness? Is the child's desire for a sleepover of greater importance than a hike in the woods or book reading event? (Note: I don’t think these are actual choices in the game but you get the idea.)
These choices are somewhat softened by having a choice and a backup. You can let the kid have his way and the mum sort of get what she wants, but the dad would still totally miss out.
Thanks to the quality of the writing and the mostly believable characters, I found that making the decision on who to favour was never about trying to ‘win’ the game, but rather about what felt right for the family.
The only problem with this is, as the story progresses, the mother’s character and plot arc is less developed than that of either the father or the child - she lacks a consistent character and the conflicts she endures are noticeably ‘softer’.
A single playthrough is a short experience, but I think that’s for the best as this kind of ‘passive’ gameplay can easily out-stay it’s welcome; especially as I’m not often a fan of this kind of ‘walking simulator’ game.
The Novelist, however, kept me playing to the ending - or ‘my’ ending at least - and I’d say it’s an ending worth getting to for anyone.
I wasn’t utterly convinced that the choices I’d made deserved every aspect of the outcome, but on the whole the pieces fit and I was about, oh lets say, 66.6% satisfied.
I don’t think it’s spoiling anything to say that a game about having one and a half choices to share between a family of three is about the difficulties of finding balance and happiness in daily life - and I won’t pretend that these ‘rules’ don’t bring a gameyness to bare that I’m not always sure always completely works - but it is successful in delivering this message, even if I don’t entirely agree with the conceit that someone always has to miss out.

The Novelist - Lovingly crafted and well told; definitely recommended for anyone in the mood for reading a good video game.

FYI: The Novelist is on sale for less than a quid/buck on Steam right now. At that price it's well worth trying for yourself
submitted by -JaguarWong- to patientgamers [link] [comments]


2020.05.26 02:43 sbuyze Contract Renewals: Views from Datto KPI#7 and SDB-Consulting

Nothing lights me up more than talking about Contract Renewals – well, maybe a few things, but this is definitely in the top 10. Why?
It seems like one of the simplest things to stay on top of. Compared to all open tickets, this is slow-moving and very tame.
Yet, when we respond to the No-Obligation PSA Configuration Evaluation, the most common finding is that there is a significant number of Contracts past their end date which are still active. That means a ticket can be created and time put against an inactive contract – work that I assume will never be billed, or at the very least, not tracked against Contract profitability.
Check for yourself. Roll over the big “A” → Contracts → Contract Search → Search (this will search all active contracts), then look at the right-hand side and see the red (Contracts past their end date).
A few things you may not realize:
  • When a Customer leaves and we inactivate them, it does not inactivate the Contract.
  • When we create a new Contract to replace the expiring one, this does not inactivate the Contract.
  • And when the Contract hits its end date, it does not automatically inactivate.
As you can imagine, this creates a lot of active Contracts past their end date.
To get the eBook from Datto, download it here.
Let’s look at what Datto has to say about the subject, before chiming in with our own thoughts.

Datto’s 7th KPI: Contract Renewal sub-article takeaways

  • To help prevent churn, Autotask PSA alerts an MSP when customers are up for Renewal with Widgets, offering visibility into expiring contracts 30, 60, and 90 days out. This helps MSPs stay ahead on documentation that needs to be worked out for renewals and leaves time for potential negotiation.
  • On average, it costs MSPs 5X more to acquire a new customer than it does to retain a current customer, so staying on top of renewals is a must.
  • In an MSP’s world, the longer the contract, the better.
  • Autotask PSA can break down the percentage of clients currently locked into deals that are greater than 12 months vs. a month-to-month contract.
  • The longer a customer is locked into a contract, the better the MSP can forecast.
  • Additionally, if mergers or acquisitions (M&A) are of any interest to the MSP, longer contracts allow them to demonstrate future bookings, which helps boost the company’s valuation.

SDB-Consulting’s take on Contract Renewal…

Sorry, but I’m just not connecting the dots here. How does an expired contract cause the Customer to leave? Think about it. If an expired contract remains active, doesn’t that mean it will never bill, or be counted against profitability?
It seems that if I am putting my time on a ticket that never gets billed or tracked against the profitability of the Contract, it is a benefit to the Customer – a practice that if I was the Customer, would make me want to stay, not leave. Now granted, if the MSP is not profitable, it won’t be sustainable and all Customers will need to leave, but I doubt that is what we are talking about here.

Autotask Fans with Conflicting Views

While we love Autotask and are raving fans of the product, we beg to differ with their opinions once in a while (ok, ok, more than once). My first reaction was that long Contracts are bad for an MSP. However, when comparing month to month (not to be confused with MRR) to a year, we agree.
I do not know any MSP (and we know a lot of them from around the world) that is selling Month-to-Month contracts. T&M maybe, but to me, that is a very different world, or the writer is using the wrong terminology – but what do I know about the English language.
The reason I feel Contracts longer than a year are bad for the industry, is that it does not force the Account Manager to have at least an annual conversation with the Customer. As a matter of fact, we are strong proponents of QBRs (yes, we have a QBR template that we are happy to share).
But we have seen too many MSPs enter into 3-year deals and then forget about them. Think of it this way:
  • What were you selling 3 years ago?
  • What was your cost basis?
  • What was your most profitable offering?
  • How were you doing business?
This industry changes all the time (duh) and annual reviews are by far the smartest way to go. If you disagree, send me an email, as I would like to know why.
The only statement that makes sense to me is having a long-term Contract that increases the valuation, as long as the VC does not look closely at the 30-day termination clause, with no financials tied to it, or the churn rate of the agreements.

📷

Who should monitor Contract Renewals?

Based on our experience, the Service Coordinator is the best person in the house to monitor Contract Renewals. Yes, we are biased – we always think they are the most important person in the building. We also think they are worth their weight in Gold, and for good reason.
As mentioned previously, almost every No-Obligation PSA Configuration Evaluation that we do discovers a number of active contracts past their end date. Which means, whoever is responsible for contract renewals is not watching the hen house (it could also mean that they are unaware of the widget that Datto is talking about).
We coach Service Coordinators to have the Contract Renewal widget on their dashboard. They are one of the people in the building who are always looking at their Autotask dashboard. When a Contract comes up for renewal, they will reach out and remind the Account Manager because they get why this is important – if not, this then is just part of their job.
When it gets down in the 60 days to renewal range, and the Account Manager gives some excuse, they will escalate it to the Owner. Even if it is the same person, they just change the phrasing from talking to an Account Manager to talking to the Owner and point out that if it is not renewed, they will be working for FREE. If that doesn’t get an owner’s attention, nothing will.
When can the Service Coordinator help the most? In the last 30 days before expiring. Believe it or not, the Service Coordinator has the best relationship in the Company with the Customer.
Are you starting to get it? The reason the Service Coordinator has the best relationship with the Customer is that they are a “balanced agenda” advocate for the Customer within the MSP’s operations both for Sales and Service.
So when the Contract is up for renewal, the Account Manager has done their job, because the Owner had a private conversation with them (even if it is the same person), and the Customer is sitting on the Contract not wanting to sign until they have to. The Service Coordinator is the one who has the right type of relationship (advocate for the Customer) to ask them, “Please sign the paper, old man” ($25 Amazon gift card for anyone that emails in with where the quote came from).
So, what is the Call to Action? Provide the Service Coordinator with a significant pay raise and Contract Renewal widget. If you need help finding the widget, give us a call. If you need help giving the pay raise, let us know and we can coach you through how to be more profitable (how does $32,200 per Tech per Year sound?). And yes, we recommend the Company gives the first Techs increased profitability to the Service Coordinator.
https://www.sbuyze.com/2020/05/20/contract-renewals-views-from-datto-kpi7-and-sdb-consulting/
submitted by sbuyze to u/sbuyze [link] [comments]


2020.05.25 03:48 jenesaisqui 21 [M4M] United Kingdom / Ireland / Anywhere - Are you also tired of how shallow people are on dating apps?

Hi!
For my pics please check imgur here.
I’m a 21 year old guy living in the UK, but originally from Italy and I have spent a few years in France as well, so I also speak French and Italian.
This year alone (before the lockdown), I’ve been stood up at 3 dates, and ghosted twice, all this after my now ex boyfriend broke up with me.
I’m somewhat sick and tired of dating apps, and as there is no real option to meet people in real life, and I feel like a fish out of water in gay bars / clubs.
Don’t hesitate to pop up in my DMs and say hi! :)
submitted by jenesaisqui to r4r [link] [comments]


2020.05.20 18:37 Memrise_Casting Looking for Native Speakers across 9 languages PAID WORK

Memrise - Self Shoot
You will be filming the videos in your home on your phone. Filming will not take place with our crew.
The rate is £150 to film up to 30 items - flat rate
Requirements We are looking for native speaking actors who are confident with self-shooting on their mobile phone. We are looking for someone who is confident, very expressive and quirky. Video Self Tape Please can you do a video self tape of you saying the below script and email it back to us. Please email your tape to [cast[email protected]](mailto:[email protected]) . Please ensure the email subject or wetransfer message says: The name of language that you are applying for. For example: MANDARIN SPEAKER SELF TAPE JAPANESE SPEAKER SELF TAPE SPANISH SPEAKER SELF TAPE MEXICAN SPANISH SPEAKER SELF TAPE USA SPEAKER SELF TAPE GERMAN SPEAKER SELF TAPE FRENCH SPEAKER SELF TAPE RUSSIAN SPEAKER SELF TAPE UK SPEAKER SELF TAPE CASTING DEADLINE: Casting is ongoing SELF SHOOTING DATE: Filming is ongoing Here is the script for the different languages. Applicants should film them self saying the below script as well as answering the questions in their native language. CHINESE - MANDARIN Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary.
A:你很可爱 B: 你也很可爱 A:我喜欢你 B:我也喜欢你 A:我爱你 B:(尴尬逃开)
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
USA ENGLISH
Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary. A: Excuse me, what's the Wi-Fi password? B: Oh, I'm sorry, we don't have Wi-Fi A: *dan dan daaann* Nooooo!!
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
UK ENGLISH Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary. A: Excuse me, what's the Wi-Fi password? B: Oh, I'm sorry, we don't have Wi-Fi A: *dan dan daaann* Nooooo!!
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
FRENCH
Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary.
A: « dis, je peux emprunter ton stylo, s'il te plaît ? » B: « oui bien sûr » A: « cool, merci ! » (prend le stylo, se met à mâcher le bout) B (complétment choqué·e)
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
MEXICAN SPANISH
Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary.
En una video llamada: Jajajaja siiii ya se.. eeeh... hola? (se congela la pantalla) Sí, yo te oigo, ¿me oyes? Holaaa? (Se pierde la señal y la persona en pantalla cuelga) (decepcionado) auuu...ok... bai?
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
JAPANESE
Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary.
(初めは関心を持って聞いてるが、だんだん相槌だけになっていくというオチ。いろんな「へー」を表現してみて欲しいです。)
A: *ねえ、ねえ、私、Youtubeチャンネル始めたんだ!\* B: へー!(びっくりのへー) A: *フォロワーが500人もいるんだよ!\* B: へー!(感心のへー) A: *ビデオ作るの、大変なんだよね\* B: へー(だんだん聞いてるフリ。食べながら、携帯をいじりながら、など) A: 。。。ねえ、聞いてる? B: へー(完全に聞いてるフリ) A: (怒って立ち去る) B: へー(一人取り残されても気づかずずっと相槌を打っている)
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
SPANISH
Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary.
Couple lying in bed
A: Eres muy gracioso B: Tú también... A: Me gustas mucho.. B: Tú a mí también A: Creo que ... te quiero B: (Looks horrified)
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
GERMAN Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary.
A: Sprichst du Deutsch? B: Ähm ein bisschen A: oh super, ist ja cool das du Deutsch sprichts, wie lange lernst du es denn schon? B: Ähm ja A: wie bitte? B: Nein
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
RUSSIAN
Please play both characters. Please be as creative with this as you like. You can film this all in one tape, edited videos are not necessary. Fell free to use different props.
Character A wearing a hat and sunglasses. Character B comes by.
B: Извините пожалуйста А: Да В: Вы разрешите? B takes A's hat and sunglasses and puts them on. Then takes selfie and gives them back. B: Спасибо A shocked
Once you have filmed the above script please also answer these questions at the end of your tape. 1-My name is... 2- I am .... years old. 3- I have been acting for... 4-My favourite film is... 5- In my spare time I enjoy...
Thanks & look forward to hearing from you all,
submitted by Memrise_Casting to polygot [link] [comments]


2020.05.17 06:12 n3x7life So I created a flowchart to streamline my online dating life

I've been in the online dating scene now since December last year and overall I'd say I've had just slightly more bad experiences than good ones. I'm not really one to beat myself up or get disheartened easily despite the annoying nature of online dating (i.e girls using old photos from 2016 when they looked much different) and the current state of the playing field.
Recently, I've been thinking about how I can create more closer connections and ultimately have a higher rate of success with the girls I match with. So I woke up yesterday morning with the idea of creating a flowchart I can use to streamline the process of online dating to create deeper connections with my matches, and ultimately get to the dating part (whether virtual or in-person) as quickly/efficiently as possible.
Here it is for all who would like to see it:
The Online Dating Flowchart - Pandemic Edition
I created this based off my experiences with various matches over the past 1-2 months and thought about all the times where I had wasted my time, or simply lost interest in who I was chatting to. Since this is based off my experiences, if you do follow it just substitute what you know works for you based on your personality and experiences.
I have 5 new matches that I have just begun chatting to, so I'm going to be trialing this flowchart basically from now and will be refining it over the coming weeks as things play out based on what works/doesn't work.
I would love to get as much feedback/thoughts on this as possible.
Lastly, I do just want to add that this is not meant to be a pickup artist kind of thing...I am not claiming to be such a person, nor do I condone that kind of activity. Just a guy trying to make (dating) life and finding the right one a little easier on all of us.
submitted by n3x7life to dating_advice [link] [comments]


2020.05.15 22:16 brokencams found on unsettlingstories.com

Wikileaks rejected a State Department document and demanded that I destroy it.

My uncle worked for the State Department. He died a couple weeks ago. As per State Department policy, whenever one of their higher-ranking employees dies, the Department sends a small team to the home of the deceased to ensure they had no sensitive documents in their possession. It’s not that they distrust their dead colleague – they just don’t trust his family.
The Department team came to my uncle’s house one morning, spent a few hours rifling through his closets and drawers, and left with a small pile of papers. They expressed their condolences for my loss, then left. I never saw them again. Not even at the funeral.
On the night I visited and found him on the floor, dying of a heart attack, he told me something. It’s something I would’ve preferred to have never heard; something that made me wish I’d gotten to his house 20 minutes later to find him dead.
“Rockville Bank. Rangeley, ME. Deposit box 4426.” The key was on the ring between his car and house keys.
I pocketed the key before the paramedics arrived. He was dead by then. I went through the motions, arranged what needed to be arranged, and let the State Department do their thing. Last week, I drove from DC up to Rangely. I showed the bank the documents proving I was in charge of my uncle’s estate and owner of the contents of the box. The bank manager unlocked the main lock on top, then left me to unlock the other one on the bottom. Inside was an envelope containing a single sheet of paper dated August 4, 2016, that looked like it had been pulled out of a fire. I took it from the box, left the bank, and read it in my car.
I have to preface this by saying I’ve never been one for conspiracy theories. In fact, I think they’re all a bunch of bullshit. We landed on the moon. Oswald killed Kennedy. Islamic terrorists brought down the twin towers. Vaccines are safe and important. None of the major conspiracy theories have been able to hold up under scrutiny, and all the exponents of the theories are, in one way or another, unhinged. But.
But.
There’s nothing inside me that can adequately explain away what I read on that sheet of paper. Yes, it might be a hoax. During the long drive back to DC, I’d almost convinced myself that it was. But my uncle wouldn’t do something like that. He took his work seriously. He was passionate and moral. All the evidence pointed to the fact the document was real. And if that were the case, people needed to know about it. That had to have been why my uncle had hidden the file away. He wanted me, or someone else, to disseminate it after his death. I made up my mind, and when I got home, I submitted it to Wikileaks.
Five minutes later, I received a phone call. “Destroy the scan you sent us. It is not real. Destroy the file and the physical document. Do not attempt to submit it again. We know who you are.”
I hadn’t provided any personal information to Wikileaks. They don’t even ask for it. And hardly anyone has my phone number. Plus, no one else knew I had that document in my possession.
If anything could have proven the document was authentic and important, that was it.
That all happened last Friday. Every day since then, I’ve gotten calls from different numbers, all asking the same questions. “Is it gone? Is it destroyed?”
Each time, I hung up without saying anything. This morning, though, the voice on the other end said something different. “You will die if that document is leaked.”
I hung up and called the police, who said they would send a car over. But I’m still worried. I am going to destroy the document, but not before I transcribe it. Not before I put it online. Even if they get me – even if they kill me – I’m not sure I want to continue living in a world where the contents of that document are real.
I’ve replaced the burn marks with dashes. The content is still discernible. The context is still available. Whatever happens with this, once it’s out in the open, my conscience can be clear. If this is my last day alive, maybe I’ll be rewarded for bringing this to light. God knows if I live through today, I may never sleep again.
U.S. Department of State: Wikileaks & JA documentation — — summary
JA ordered multiple attempts on the — of BO JB HC according to — sources in — of Ecuador, London. Electronic surveillance of the — is ongoing, although human intelligence —. Following — offer of funding, most attempts linked to JA have stopped. Tactical reversion to JA — Embassy of Ecuador, London — budget to silence sexual assault — and smear accusers in tabloid — as promiscuous or drug users.
JA has accepted the — GBP sum in exchange for keeping secret US UK BZ IT — for refugee experimentation. (See cable —) — experimentation via biological, chemical, radiological, —
— — refugee populations in SY being moved — — —, though Ciprofloxacin shortage makes it difficult to keep enough alive before reaching BZ and IT labs. JA accepting variable sums to hold back information — to sick and dying refugees.
JA received cables — from RU re: US initial success in UK lab — Zika manipulation. Zika reengineering and subsequent failure — reanimation of dead tissue via adrenochrome.
Loss of containment in FL, US, GA, US, LON, UK — some bodies regaining movement and autonomy — — following brain death. In some cases, full recovery. — motivation altered. Wikileaks and JA rejecting — reports for GBP 1M per. Google, Yahoo, Microsoft, and others complying — —.
Final note:
JA assassination attempt on — — 2016 reported successful by — Ecuador, London and US team — via gunshot wound to head. Body — reanimated likely — dormant Zika — accidental exposure to lost mosquito — LON, UK lab. JA new motivation unknown. Gunshot — covered by hair styled — over wounds. Still responsive to — and communication.
Internet in general still unaware of bioengineered — outbreak. — and family of citizens in US and UK — — reanimated dead without anyone knowing it. Monitor cables from — and RU. Avoid mosquito exposure.
submitted by brokencams to deepstate [link] [comments]


2020.05.11 16:25 elinas6 BOL4 - Social Media, Discography, Music Videos & Variety Content Links

Discography, Music Videos, Variety Content, Social Media (SNS) & Updates
YouTube: 볼빨간사춘기 BOL4, 안녕, 안졍 (Ahn Jiyoung), Shofar Music
Instagram: @official_bol4, @hey_miss_true, @shofar_music
Twitter: @BOL4_Official, @bolbbalgan4, @bol4_japan, @ShofarMusic
Facebook: @BOL4.Official, @ShofarMusic
V LIVE: BOL4, Shofar Music
Streaming/Download Links:
Apple Music/iTunes
Spotify, All BOL4 Spotify Songs - Playlist
YouTube Music, Google Play Music
Amazon Music (Downloads) #1, #2
Amazon Music Unlimited (Streaming) #1, #2, #3, More
MVs:
Hug, Bom (JP), Leo (feat. BAEKHYUN), Awkward, LOVE, New York (#2, #3), Workaholic, 25, To My Youth (JP), Galaxy (JP), Bom, Stars Over Me, Dejavu (Live), Travel, Starlight, Wind, #First Love (Live), Some, Fix Me, Imagine, Blue, We Loved, Tell Me You Love Me, Galaxy, Hard to Love, Fight Day
OST/CF: 여기어때요 (with Paul Kim), 바람이 불어오는 곳, Please Summer!, Nisha Labyrinth, My Trouble, First, Song of the Moonlight, You and I from the Beginning, Dream, Hello, The Covered Up Road
Misc: To My Youth + Travel (2019 GDA), Lonely (Dingo Live), Galaxy (How Are You.mov), Travel (Epilogue), Fix Me (Real Barrier CF), You(=I), Galaxy Bugs! CF, Picnic (LG CF), More
Other Streaming/Download Links:
South Korea: Melon, Genie, FLO, Bugs, Soribada, Naver VIBE
Japan: Apple Music, Spotify, Google Play, Line Music, AWA, Amazon, KKBOX, RecoChoku, Mora
China: Tencent QQ Music, NetEase
Other:
BOL4 - Topic YouTube, BOL4 Japan YouTube
JOOX, KKBOX: Taiwan, Hong Kong, Singapore, Malaysia
Odd Child (낯선아이, Woo Jiyoon):
Instagram @bssazzzn
ODDCHILD YouTube, Odd Child - Topic YouTube
Spotify, Apple Music, YouTube Music
Soundcloud

Discography

Albums/Singles

Music Releases
Apple Music/Spotify Released: 2020-05-13
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Blank (빈칸을 채워주시오) YouTube Audio, Short Film, 2nd Link Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
2. Hug (품) [Title Track] MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
3. Leo (나비와 고양이) feat. BAEKHYUN (백현) [Title Track] MV, 2nd Link, YouTube Audio, 2nd Link Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
4. Counseling (카운슬링) YouTube Audio, Short Film, 2nd Link Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
5. Dandelion (민들레) YouTube Audio Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
- Song Previews
<私だけ、春 (Bom (JP Ver.)) - JP Single>
Spotify, Other Released: 2020-05-08
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. 私だけ、春 (Watashidake, haru) [Bom (JP Ver.)] Lyric MV Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung, Vanilla Man Vanilla Man
2. Stars Over Me (JP Ver.) Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung, Vanilla Man Vanilla Man
-
Apple Music/Spotify Released: 2020-05-07
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Leo (나비와 고양이) [feat. EXO BAEKHYUN (백현)] MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
-
Apple Music/Spotify Released: 2020-01-15
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Awkward (어색한 사이) [Title Track] MV, 2nd Link, YouTube Audio Vanilla Man Vanilla Man Vanilla Man
2. Happiness is all around (행복은 늘 가까이에 있어) YouTube Audio 20 Years of Age 20 Years of Age 20 Years of Age, 818
-
Spotify/Other Released: 2020-01-15
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. LOVE MV Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung, Vanilla Man
2. Blue (JP Ver.) Ahn Jiyoung, JP Lyrics: PA-NON Ahn Jiyoung Vanilla Man
3. LOVE (Instrumental) Ahn Jiyoung, Vanilla Man
4. Blue (Instrumental) Ahn Jiyoung Vanilla Man
-
Apple Music/Spotify Released: 2019-11-27
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. New York MV, 2nd Link, Live Clip #1, 2nd Link, Live Clip #2, 2nd Link, YouTube Audio WH3N WH3N Avalon 8
-
Apple Music/Spotify Released: 2019-09-10
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Workaholic (워커홀릭) [Title Track] MV, 2nd Link, YouTube Audio, YHY Sketchbook 2019, Two Five Tour 2019 Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
2. 25 MV, 2nd Link, YouTube Audio, Two Five Tour 2019 Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
3. XX YouTube Audio, Short Film (0:27) Ahn Jiyoung Ahn Jiyoung Hwang Jong Ha
4. Taste YouTube Audio, Short Film (0:25) Ahn Jiyoung Ahn Jiyoung Vanilla Man
5. 낮 (Day off) YouTube Audio, Two Five Tour 2019 Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Vanilla Man Vanilla Man
6. XX (Acoustic Version) YouTube Audio Ahn Jiyoung Ahn Jiyoung Vanilla Man
- Song Previews Video
<私の思春期へ (To My Youth (JP Ver.)) / Some (JP Ver.) - JP Single>
Spotify/Other Released: 2019-08-07
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. 私の思春期へ (To My Youth (JP Ver.)) MV Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung Vanilla Man
2. Some (JP Ver.) YouTube Audio Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung, Vanilla Man Vanilla Man
-
Spotify Released: 2019-06-05
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Galaxy (Japanese Edition) / 宇宙をあげる MV Ahn Jiyoung, Woo Jiyoon, JP Lyrics: Kanata Okajima Ahn Jiyoung, Vanilla Man Vanilla Man
2. Tell Me You Love Me (Japanese Edition) / 好きだと言って YouTube Audio Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung, Vanilla Man Vanilla Man
3. Fight Day (Japanese Edition) / 喧嘩した日 Ahn Jiyoung, JP Lyrics: PA-NON Ahn Jiyoung Vanilla Man
4. You(=I) [Japanese Edition] Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung Vanilla Man
5. Mean/Grumpy (Japanese Edition) / 意地悪 Ahn Jiyoung, JP Lyrics: Chef Watanabe Ahn Jiyoung Vanilla Man
6. Hard to Love (Japanese Edition) / 私だけダメな恋 Ahn Jiyoung, JP Lyrics: Kanata Okajima Ahn Jiyoung Vanilla Man
-
Apple Music/Spotify Released: 2019-04-02
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Picnic (나들이 갈까) YouTube Audio, 2017 LG G6 Commercial MV Woo Jiyoon Woo Jiyoon Vanilla Man
2. Bom (나만, 봄) [Title Track] MV, 2nd Link, YouTube Audio, Teaser, M Countdown Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
3. Stars Over Me (별 보러 갈래?) [Title Track] MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
4. Seattle Alone YouTube Audio, Short Film (0:32), 2019 Blossom Concert Live Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
5. Mermaid [Title Track] YouTube Audio, Short Film (0:19), M Countdown, Two Five Tour 2019 Ahn Jiyoung Ahn Jiyoung Vanilla Man
- Song Previews Video, 1theK LiveONE Album Discussion & Performances (Eng Sub/CC in Settings)
Apple Music/Spotify Released: 2018-07-17
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Dejavu [Title Track] YouTube Audio, Concert Live Ahn Jiyoung, Vanilla Man Vanilla Man Vanilla Man
2. 6 o'clock YouTube Audio Ahn Jiyoung Ahn Jiyoung Vanilla Man
-
Apple Music/Spotify Released: 2018-05-24
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Wind (바람사람) [Title Track] MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung Lee Taek Seung
2. Travel (여행) [Title Track] MV, 2nd Link, YouTube Audio, Bonus Epilogue, 2018 MMA, 2019 GDA, 2nd Link Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
3. Starlight (야경) MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung Hwang Jong Ha
4. Dear. Teddy Bear (안녕, 곰인형) YouTube Audio Ahn Jiyoung Ahn Jiyoung Lee Seung Joo
5. Clip YouTube Audio Woo Jiyoon Woo Jiyoon Vanilla Man
6. Lonely YouTube Audio, Dingo Live Ahn Jiyoung Ahn Jiyoung Ahn Jiyoung
7. Travel (여행) [Instrumental] {CD Bonus Track} Ahn Jiyoung, Vanilla Man Vanilla Man
- 1theK LiveONE Album Discussion & Performances (Eng Sub/CC in Settings)
<#First Love (#첫사랑) - Dingo Music Project Single>
Apple Music/Spotify Released: 2018-01-10
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. #First Love (#첫사랑) YouTube Audio, Dingo Live, Two Five Tour 2019 Kim Ji Soo Kim Ji Soo Hwang Jong Ha
-
Apple Music/Spotify Released: 2017-09-28
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Some (썸 탈꺼야) [Title Track] MV, 2nd Link, YouTube Audio, Concert Promo Clip (1:20) Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
2. Blue YouTube Audio, Short MV (1:00), 2nd Link Ahn Jiyoung Ahn Jiyoung Vanilla Man
3. Fix Me (고쳐주세요) MV, 2nd Link, YouTube Audio, Real Barrier Commercial MV Woo Jiyoon, Vanilla Man Vanilla Man Vanilla Man
4. Imagine (상상) YouTube Audio, Short MV (1:00), 2nd Link Woo Jiyoon Woo Jiyoon Vanilla Man
5. To My Youth (나의 사춘기에게) [Title Track] YouTube Audio, 2019 GDA, 2nd Link Ahn Jiyoung Ahn Jiyoung Vanilla Man
6. Some (썸 탈꺼야) [Chic Ver.] {CD Bonus Track} 2017 MAMA Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
- 1theK LiveONE Album Discussion & Performances (Eng Sub/CC in Settings)
Apple Music/Spotify Released: 2017-06-13
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. We Loved (남이 될 수 있을까) MV, 2nd Link, YouTube Audio, 2017 YHY Sketchbook Vanilla Man Vanilla Man Vanilla Man
-
Apple Music/Spotify Released: 2016-12-21
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. 좋다고 말해 (Tell Me You Love Me) MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
-
Apple Music/Spotify Released: 2016-08-29
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Galaxy (우주를 줄게) [Title Track] MV, 2nd Link, YouTube Audio, 2nd Link, Bugs! Commercial MV, Safety Streetlight CF Version MV Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Vanilla Man Vanilla Man
2. Fight Day (싸운날) MV, 2nd Link, YouTube Audio, 2nd Link Ahn Jiyoung Ahn Jiyoung Vanilla Man
3. You(=I) Concert Promo MV, YouTube Audio, 2nd Link, 2017 YHY Sketchbook Ahn Jiyoung Ahn Jiyoung Vanilla Man
4. Mean (심술)/Grumpy YouTube Audio, 2nd Link, Pikicast Live Ahn Jiyoung Ahn Jiyoung Vanilla Man
5. Hard to Love (나만 안되는 연애) [Title Track] MV, 2nd Link, YouTube Audio, 2nd Link Ahn Jiyoung Ahn Jiyoung Vanilla Man
6. Chocolate (초콜릿) YouTube Audio, 2nd Link Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Vanilla Man Vanilla Man
7. Freesia (프리지아) YouTube Audio, 2nd Link Ahn Jiyoung Ahn Jiyoung Hwang Jong Ha
8. X Song YouTube Audio, 2nd Link Vanilla Man Vanilla Man Vanilla Man
9. Ring (반지) YouTube Audio, 2nd Link Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Woo Jiyoon Vanilla Man
10. When I Fall in Love (사랑에 빠졌을 때) YouTube Audio, 2nd Link, Concert Promo Clip (0:54) Ahn Jiyoung Ahn Jiyoung Vanilla Man
11. Galaxy (우주를 줄게) [Radio Edit] {CD Bonus Track} Ahn Jiyoung Ahn Jiyoung, Vanilla Man Vanilla Man
- 1theK LiveONE Album Discussion & Performances (Eng Sub/CC in Settings)
Apple Music/Spotify Released: 2016-04-22
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. 초콜릿 (Chocolate) YouTube Audio Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Vanilla Man Vanilla Man
2. 싸운날 (Fight Day) [Title Track] MV, 2nd Link, YouTube Audio Ahn Jiyoung Ahn Jiyoung Vanilla Man
3. 반지 (Ring) [Title Track] YouTube Audio Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Woo Jiyoon Vanilla Man
4. 심술 (Mean/Grumpy) [Title Track] YouTube Audio, Pikicast Live Ahn Jiyoung Ahn Jiyoung Vanilla Man
5. 가끔씩 (우지윤의 보컬 스틸) [Occasionally (Woo Jiyoon Solo Vocal)] YouTube Audio Woo Jiyoon Woo Jiyoon, Vanilla Man Vanilla Man
-
Apple Music, Spotify Released: 2016-01-08
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Romantic Wish YouTube Audio Vanilla Man, Raingray Vanilla Man Vanilla Man

OST

OST Songs
Track Links From Lyrics By (작사) Composed By (작곡) Arranged By (편곡) Released
My Trouble MV, YouTube Audio WHY : The Real Reason You Got Dumped (당신이 연인에게 차인 진짜 이유) OST Part 1 Vanilla Man Vanilla Man Vanilla Man 2018-11-15
You and I from the Beginning (처음부터 너와 나) MV Ruler: Master of the Mask (앨범명 군주 - 가면의 주인) OST Part 2 Vanilla Man Vanilla Man Vanilla Man 2017-05-17
Dream (드림) MV Hwarang (화랑) OST Part 3 June Oh Joon Sung Oh Joon Sung, Kim Sung Eun 2016-12-27
The Covered Up Road (가리워진 길) [Band Ver.] YouTube Audio Misaeng (미생) Incomplete Life OST Yoo Jae Ha Yoo Jae Ha Park Asher 2014-12-24
The Covered Up Road (가리워진 길) YouTube Audio, Kim Je Dong's Talk to You Misaeng (미생) Incomplete Life OST Part 4 Yoo Jae Ha Yoo Jae Ha Park Asher 2014-12-05

Features

Features
Track Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡) Released
Sweden Laundry (스웨덴세탁소) feat. BOL4 (볼빨간사춘기) - Be Your Christmas YouTube Audio, 1theK Special Clip Live Wang Seyoon, Choi Inyoung Choi Inyoung Vanilla Man, Cho Hyunsuk 2018-12-10
ELRIS' SOHEE (엘리스 소희) feat. BOL4 (볼빨간사춘기) - Hurry Up MV Ahn Jiyoung, Woo Jiyoon Ahn Jiyoung, Vanilla Man Vanilla Man 2018-10-18
San E (산이) feat. Bolbbalgan4 (볼빨간사춘기) - Mohae (모해) MV San E San E, Cosmic Sound, Cosmic Girl Cosmic Sound, Cosmic Girl 2017-05-23
Mad Clown (매드클라운) feat. Bolbbalgan4 (볼빨간사춘기) - Lost Without You (우리집을 못 찾겠군요) MV Mad Clown Mad Clown, Ye-Yo! Ye-Yo!, Kwon Brothers 2017-02-03
Kim Ji Soo (김지수) feat. Bolbbalgan4 (볼빨간사춘기) - A Man's Confession (상남자의 고백) YouTube Audio, Arirang I'm Live Kim Ji Soo Kim Ji Soo Kim Ji Soo 2014-12-12
Sosimboys (소심한 오빠들) feat. Bolbbalgan4 (볼빨간사춘기) - Farewell Restaurant (이별맛집) YouTube Audio 목동오빠, 교회오빠 오빠사운드, 염소오빠 오빠사운드, 염소오빠 2014-11-17

Odd Child (Woo Jiyoon)

Odd Child (낯선아이)
Apple Music/Spotify Released: Released: 2020-06-18
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. DODO (도도) YouTube Audio AVOR (Woo Jiyoon), MooF AVOR (Woo Jiyoon), MooF AVOR (Woo Jiyoon), MooF
2. Island (섬) MV, Drawing MV, YouTube Audio AVOR (Woo Jiyoon), MooF AVOR (Woo Jiyoon), MooF AVOR (Woo Jiyoon), MooF
-
<~ - Mini Album>
Apple Music/Spotify Released: 2018-01-05
Track List Links Lyrics By (작사) Composed By (작곡) Arranged By (편곡)
1. Hedgehog (고슴도치) YouTube Audio AVOR (Woo Jiyoon) AVOR (Woo Jiyoon), Flare (MooF Sunae) Flare (MooF Sunae)
2. Hiccup (딸꾹질) [Title Track] YouTube Audio AVOR (Woo Jiyoon) AVOR (Woo Jiyoon), Flare (MooF Sunae) Flare (MooF Sunae)
3. Beaker (비이커) YouTube Audio AVOR (Woo Jiyoon) AVOR (Woo Jiyoon), Flare (MooF Sunae) Flare (MooF Sunae)
4. Stranger YouTube Audio AVOR (Woo Jiyoon) AVOR (Woo Jiyoon), Flare (MooF Sunae) Flare (MooF Sunae)
5. Obsession YouTube Audio AVOR (Woo Jiyoon) AVOR (Woo Jiyoon), Flare (MooF Sunae) Flare (MooF Sunae)
6. Bambi YouTube Audio AVOR (Woo Jiyoon) AVOR (Woo Jiyoon), Flare (MooF Sunae), Space One Flare (MooF Sunae), Space One

Other

Download Exclusive or YouTube/Soundcloud/Instagram Stream Exclusive Songs
Song: Links: Released:
BOL4 - Confession Song (고백쏭) YouTube (YHY Sketchbook Ep. 334) 2016-09-09
BOL4 - Galaxy (Safety Streetlight Commercial Version) YouTube MV 2017-09-24
Woo Jiyoon - FIANCÉ (WINNER MINO Cover) Soundcloud, Blossom Concert Live 2019-05-06
Woo Jiyoon - Boy With Luv (BTS feat. Halsey Cover) Soundcloud, Fancam, Fancam 2 2019-05-06
BOL4 - Styler Song (LG TROMM Styler Commercial Song) LG TROMM Styler Commercial, Full Song - Free Download 2019-07-01
Woo Jiyoon - 하고 마는 말 (with 109 (일공구)) YouTube Link, Instagram IGTV 2020-05-08

Live Performances

Day off (Two Five Tour 2019)
Mermaid
Workaholic
#First Love
25
Stars Over Me (Sketchbook Acoustic)
Bom (Sketchbook Acoustic)
Workaholic (Sketchbook Live)
25 (Showcase)
Seattle Alone (Blossom Concert)
Bom (Idol Room Acoustic)
Bom (M Countdown)
Travel (2018 Melon Music Awards)
Some (Chic Version) [2017 MAMA]
When I Fall in Love + Freesia + Fight Day + Hard to Love + Galaxy (Orgel Live Acoustic)
You(=I) [Acoustic]

Covers

Adele - Chasing Pavements
AKMU - Haughty Girl
Amy Winehouse/Mark Ronson - Valerie
Amy Winehouse - You Know I'm No Good
Ariana Grande - thank u, next
Billie Eilish - wish you were gay / bad guy
BLACKPINK - Forever Young
BTS feat. Halsey - Boy With Luv
CHUNG HA - Roller Coaster
DEAN - D (Half Moon)
G-DRAGON - Untitled, 2014
HENRY - Girlfriend
Hwa Sa - TWIT
Imagine Dragons - Believer
IU/Wheesung & G. Gorilla - Rain Drop
Jannabi - For Lovers Who Hesitate
Jay Park - Joah
Jung In - Rainy Season
Justin Bieber - Love Yourself (with HENRY)
Maroon 5 - Payphone + One Direction - What Makes You Beautiful + Lady Gaga - Poker Face
MINO - FIANCÉ
Naomi Scott - Speechless (from Aladdin OST)
Red Velvet - Psycho
Vanilla Acoustic feat. Heize - Blind Date
Zion.T - Eat
See More

Awards/Achievements

Gaon Music Chart Milestones/Certifications
Song Release Date Over 2,500,000 Downloads (250만 다운로드) Over 100,000,000 Streams (1억 스트리밍)
1. Galaxy 2016-08-29 2018-09-11 200 Million (2019-11-26), 100 Million (2018-09-11)
2. Hard to Love 2016-08-29 2018-09-11 2018-09-11
3. Tell Me You Love Me 2016-12-21 2018-09-11 2018-09-11
4. We Loved (with 20 Years of Age) 2017-06-13 2018-12-11 2018-09-11
5. Some 2017-09-28 2019-02-08 2018-09-11
6. Travel 2018-05-24 2019-04-11 2018-11-08
7. You and I from the Beginning 2017-05-17 2019-06-20 2018-09-11
8. To My Youth 2017-09-28 2019-05-03 2019-09-19
9. Bom 2019-04-02 2020-06-11
iChart All Kills
Realtime All Kill (RAK) #1 on All Realtime Hourly Charts on Current Major Streaming Platforms
Certified All Kill (CAK) #1 on All Daily & Realtime Hourly Charts
Perfect All Kill (PAK) #1 on iChart Weekly and All Daily & Realtime Hourly Charts
Song All Kill Peak
Tell Me You Love Me CAK
We Loved (BOL4, 20 Years of Age) CAK
Some PAK
#First Love RAK
Travel PAK
Bom RAK
Workaholic PAK
Gaon Chart Music Awards
Year Award Result
2017 Discovery of the Year - Indie Won
Artist of the Year (Digital Music)
2017 December 2016 Tell Me You Love Me Top 5 (2nd)
2018 June 2017 We Loved Top 5 (3rd)
2018 September 2017 Some Top 5 (2nd)
2019 January 2018 #First Love Top 5 (3rd)
2019 May 2018 Travel Top 5 (1st)
2020 April 2019 Bom Top 5 (1st)
2020 April 2019 Stars Over Me Top 5 (4th)
2020 September 2019 Workaholic Top 5 (2nd)
Golden Disc Awards (GDA)
Year Award
2017 Rookie of the Year Won
2018 Digital Bonsang Tell Me You Love Me
2019 Digital Bonsang Travel
Korean Music Awards (KMA)
Year Award For
2017 Song of the Year - Daesang Galaxy
Melon Music Awards - Top 10 Artists of the Year
No Particular Order Given
2017 2018 2019
BOL4 BOL4 BOL4
BTS BTS BTS
EXO EXO EXO
Heize Apink Heize
IU Mamamoo Mamamoo
Twice Twice Chung Ha
Wanna One Wanna One Jang Beom June
Red Velvet Blackpink Jannabi
Big Bang BtoB M.C the Max
Winner iKon Taeyeon
Other MMA Awards
Year Award For
2016 Best Indie Galaxy
Mnet Asian Music Awards (MAMA)
Year Award For
2017 Best Vocal Performance Group Tell Me You Love Me
2019 Best Vocal Performance Group Bom
Seoul Music Awards (SMA)
Year Award
2018 Bonsang Award
Asia Artists Awards
Year Award
2017 Best Entertainer Award (Music Category)
Soribada Best K-Music Awards
Year Award
2018 Bonsang Award
Music Show Wins
Song Show Show Date
1. Some - 1st Win SBS MTV The Show (Ep. 128) 2017-10-17
2. Some - 2nd Win SBS Inkigayo (No Broadcast) 2017-10-22
3. Travel - 1st Win SBS Inkigayo (Ep. 962) 2018-06-17
4. Workaholic - 1st Win KBS Music Bank (Ep. 996) 2019-09-20
5. Workaholic - 2nd Win MBC Show! Music Core (Ep. 649) 2019-09-21
6. Workaholic - 3rd Win SBS Inkigayo (Ep. 1018) 2019-09-22
7. Workaholic - 4th Win MBC Music Show Champion (Ep. 333) 2019-09-25
8. Workaholic - 5th Win MBC Show! Music Core (Ep. 650) 2019-09-28
9. Workaholic - 6th Win SBS Inkigayo (Ep. 1019) 2019-09-29
YouTube Rewind Korea
Top 10 Most Popular Music Videos of the Year
2018 2019
1. iKON - LOVE SCENARIO 1. BTS - Boy With Luv (feat. Halsey)
2. BLACKPINK - DDU-DU DDU-DU 2. ITZY - DALLA DALLA
3. MOMOLAND - BBoom BBoom 3. TWICE - FANCY
4. TWICE - What is Love? 4. BLACKPINK - Kill This Love
5. BTS - FAKE LOVE 5. N.Flying - Rooftop
6. Red Velvet - Bad Boy 6. Naomi Scott - Speechless (from Aladdin)
7. TWICE - Dance The Night Away 7. ITZY - ICY
8. BOL4 - Travel 8. Billie Eilish - Bad Guy
9. BTS - IDOL 9. BOL4 - Bom
10. MAMAMOO - Starry Night 10. Jvcki Wai, Young B, Osshun Gum, Han Yo Han - Dding (PROD. By GIRIBOY)
submitted by elinas6 to Bolbbalgan4 [link] [comments]


YouTube Dating in the UK! - YouTube Bigg Jah - YouTube (UK) Dating In The Dark - Season 4 Episode 4 *NEW* (HD ... (UK) Dating in the Dark Season 4 Ep. 2 - YouTube Dating Amber  Official Trailer  Prime Video - YouTube nude dating show in the UK - YouTube First Dates - YouTube

JWMatch - Jehovah's Witnesses And Friends Dating - Home Page

  1. YouTube
  2. Dating in the UK! - YouTube
  3. Bigg Jah - YouTube
  4. (UK) Dating In The Dark - Season 4 Episode 4 *NEW* (HD ...
  5. (UK) Dating in the Dark Season 4 Ep. 2 - YouTube
  6. Dating Amber Official Trailer Prime Video - YouTube
  7. nude dating show in the UK - YouTube
  8. First Dates - YouTube
  9. The disappointments of Dating as a Black Woman - YouTube
  10. Meet Local Grannies UK Granny Dating Free Granny ...

You guys ALWAYS ask us about our relationship, are we siblings? Are we married? Are we a couple? Are we friends? So today we chat about our dating lives and ... Things begin to unravel when best friends Eddie and Amber decide to embark on a fake relationship to avoid questions about their sexuality. » SUBSCRIBE: http... BritishGrannies.co.uk Meet a lot of mature women online! For those who have felt disappointed with dating, I made this book for you http://thegameofdesire.com/buy Black women discuss why dating as a black woman is ... nude dating show in the UK like and subcribe please. nude dating show in the UK like and subcribe please. (UK) Dating In The Dark - Season 4 Episode 4 *NEW* (HD)(UK) Dating In The Dark - Season 4 Episode 4 (Part 1 HD) Part 2: /watch?v=kRt3QsnAywM. Interesting bal... You only get one chance to make a first impression - and these couples are sharing it with the world. Be a part of every moment as carefully selected couples... funny filmmaker that creates visuals of various genres The daters cosy up with a drink or two, while the arrival of cheeky naked butler Steven stirs things up. Enjoy the videos and music you love, upload original content, and share it all with friends, family, and the world on YouTube.